Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5ANK5

Protein Details
Accession T5ANK5    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-54GSNLHVKQMKKRCPNSRYIGRARHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.833, cyto_mito 9.832, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009288  AIG2-like_dom  
IPR017939  G-Glutamylcylcotransferase  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
Gene Ontology GO:0003839  F:gamma-glutamylcyclotransferase activity  
Pfam View protein in Pfam  
PF06094  GGACT  
CDD cd06661  GGCT_like  
Amino Acid Sequences MAADTIDTTAASTVNNTAAAAARPTKYYFAYGSNLHVKQMKKRCPNSRYIGRARLSNHRWQINERGYANIVEADGHRVDGLVYEIDDKDEAKLDINEGVSKNAYQKRYLPVLLHRAQGPLYRRPVSWIVDKGGPAAVCRRINNKAGPGPSPSAPPRQHWESDVLVYISLNHVQDSAPKDEYVHRLNLGIVDAKALGVDDDYIRKCIRPFIPEASPNPSHQHHSSGETARPKSATRGVKRSTPSRTGEPSPARKGHVTNRPDEQNLHRALVRMPPNASTENVRGRSQPPRPLTPLRSRAVRRYYDAPVITVEEYMADWEWASSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.12
7 0.15
8 0.17
9 0.18
10 0.2
11 0.22
12 0.24
13 0.24
14 0.26
15 0.25
16 0.25
17 0.28
18 0.27
19 0.31
20 0.36
21 0.35
22 0.35
23 0.38
24 0.37
25 0.42
26 0.51
27 0.55
28 0.57
29 0.67
30 0.74
31 0.76
32 0.82
33 0.82
34 0.82
35 0.81
36 0.79
37 0.78
38 0.7
39 0.69
40 0.63
41 0.64
42 0.6
43 0.59
44 0.59
45 0.55
46 0.55
47 0.54
48 0.6
49 0.56
50 0.57
51 0.49
52 0.44
53 0.4
54 0.38
55 0.34
56 0.25
57 0.18
58 0.12
59 0.12
60 0.12
61 0.11
62 0.11
63 0.1
64 0.09
65 0.09
66 0.08
67 0.09
68 0.06
69 0.06
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.08
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.12
82 0.13
83 0.15
84 0.14
85 0.15
86 0.13
87 0.14
88 0.2
89 0.24
90 0.25
91 0.24
92 0.28
93 0.31
94 0.35
95 0.36
96 0.32
97 0.32
98 0.39
99 0.39
100 0.37
101 0.33
102 0.29
103 0.29
104 0.3
105 0.29
106 0.26
107 0.3
108 0.29
109 0.29
110 0.32
111 0.35
112 0.33
113 0.35
114 0.31
115 0.28
116 0.28
117 0.28
118 0.24
119 0.22
120 0.19
121 0.14
122 0.15
123 0.18
124 0.19
125 0.21
126 0.24
127 0.27
128 0.31
129 0.33
130 0.34
131 0.32
132 0.31
133 0.31
134 0.3
135 0.28
136 0.25
137 0.26
138 0.24
139 0.28
140 0.28
141 0.29
142 0.32
143 0.33
144 0.33
145 0.3
146 0.32
147 0.25
148 0.24
149 0.22
150 0.16
151 0.12
152 0.11
153 0.1
154 0.07
155 0.08
156 0.07
157 0.06
158 0.06
159 0.06
160 0.1
161 0.13
162 0.16
163 0.15
164 0.15
165 0.16
166 0.19
167 0.23
168 0.22
169 0.2
170 0.18
171 0.17
172 0.17
173 0.17
174 0.14
175 0.11
176 0.09
177 0.08
178 0.07
179 0.06
180 0.06
181 0.05
182 0.05
183 0.03
184 0.04
185 0.04
186 0.08
187 0.09
188 0.11
189 0.11
190 0.13
191 0.13
192 0.2
193 0.22
194 0.22
195 0.25
196 0.29
197 0.35
198 0.37
199 0.4
200 0.39
201 0.38
202 0.36
203 0.37
204 0.34
205 0.32
206 0.3
207 0.32
208 0.27
209 0.29
210 0.32
211 0.31
212 0.35
213 0.37
214 0.37
215 0.34
216 0.34
217 0.31
218 0.3
219 0.35
220 0.39
221 0.39
222 0.47
223 0.48
224 0.53
225 0.58
226 0.61
227 0.59
228 0.57
229 0.54
230 0.52
231 0.55
232 0.52
233 0.56
234 0.57
235 0.58
236 0.58
237 0.57
238 0.54
239 0.51
240 0.52
241 0.52
242 0.53
243 0.49
244 0.46
245 0.5
246 0.52
247 0.51
248 0.5
249 0.46
250 0.45
251 0.44
252 0.41
253 0.36
254 0.32
255 0.32
256 0.36
257 0.36
258 0.32
259 0.3
260 0.3
261 0.33
262 0.33
263 0.34
264 0.31
265 0.31
266 0.36
267 0.38
268 0.37
269 0.37
270 0.4
271 0.48
272 0.5
273 0.53
274 0.51
275 0.55
276 0.61
277 0.66
278 0.7
279 0.7
280 0.71
281 0.68
282 0.7
283 0.69
284 0.71
285 0.71
286 0.68
287 0.63
288 0.6
289 0.61
290 0.59
291 0.55
292 0.47
293 0.4
294 0.38
295 0.32
296 0.27
297 0.21
298 0.13
299 0.12
300 0.13
301 0.11
302 0.08
303 0.08