Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AL39

Protein Details
Accession T5AL39   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
103-122GPVRRGRRPGDRCRKRRAGABasic
NLS Segment(s)
PositionSequence
55-62RPGRRPGW
69-121SAAPPGPPPGPRRRHRPRSTGGGPRAGRRGGPYCGPVRRGRRPGDRCRKRRAG
Subcellular Location(s) cyto 11, mito 10, extr 5
Family & Domain DBs
Amino Acid Sequences MMGHGVLVRAGGRVVALVAAAKDAGKGAQADEEAGRRDLPGPCLAQRGHHGAPWRPGRRPGWAPESTWSAAPPGPPPGPRRRHRPRSTGGGPRAGRRGGPYCGPVRRGRRPGDRCRKRRAGAPAEGDDVSGRKGQQQLAQMLAGLDPAEVGLDLRRRVGRGWRGGPEDAGADQGHCLSERLSHEVWSLLLNHETRFDVDVLPVPVSVYMVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.1
16 0.1
17 0.12
18 0.13
19 0.15
20 0.16
21 0.17
22 0.16
23 0.14
24 0.18
25 0.19
26 0.2
27 0.22
28 0.22
29 0.23
30 0.28
31 0.27
32 0.26
33 0.28
34 0.32
35 0.29
36 0.28
37 0.32
38 0.31
39 0.4
40 0.47
41 0.48
42 0.44
43 0.5
44 0.5
45 0.53
46 0.54
47 0.51
48 0.49
49 0.47
50 0.45
51 0.41
52 0.44
53 0.37
54 0.32
55 0.26
56 0.19
57 0.18
58 0.17
59 0.16
60 0.15
61 0.17
62 0.2
63 0.26
64 0.34
65 0.42
66 0.47
67 0.56
68 0.62
69 0.71
70 0.75
71 0.78
72 0.74
73 0.74
74 0.75
75 0.74
76 0.66
77 0.64
78 0.57
79 0.52
80 0.49
81 0.4
82 0.33
83 0.28
84 0.28
85 0.21
86 0.22
87 0.22
88 0.23
89 0.25
90 0.29
91 0.31
92 0.35
93 0.41
94 0.46
95 0.49
96 0.55
97 0.61
98 0.69
99 0.74
100 0.77
101 0.77
102 0.79
103 0.81
104 0.73
105 0.71
106 0.7
107 0.66
108 0.62
109 0.6
110 0.52
111 0.46
112 0.44
113 0.37
114 0.28
115 0.2
116 0.15
117 0.12
118 0.1
119 0.1
120 0.13
121 0.15
122 0.18
123 0.23
124 0.23
125 0.23
126 0.23
127 0.2
128 0.18
129 0.16
130 0.12
131 0.07
132 0.05
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.06
139 0.09
140 0.1
141 0.13
142 0.14
143 0.15
144 0.18
145 0.26
146 0.32
147 0.37
148 0.42
149 0.45
150 0.48
151 0.48
152 0.47
153 0.38
154 0.32
155 0.23
156 0.2
157 0.14
158 0.1
159 0.1
160 0.1
161 0.09
162 0.08
163 0.09
164 0.07
165 0.12
166 0.14
167 0.2
168 0.2
169 0.21
170 0.21
171 0.21
172 0.22
173 0.18
174 0.17
175 0.13
176 0.17
177 0.17
178 0.17
179 0.18
180 0.19
181 0.19
182 0.2
183 0.19
184 0.15
185 0.16
186 0.2
187 0.2
188 0.19
189 0.17
190 0.16
191 0.15