Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AAP6

Protein Details
Accession T5AAP6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-130VQKRRHGFLHRKRSKTGRRILLRRRIKGRRQLAWBasic
NLS Segment(s)
PositionSequence
99-127KRRHGFLHRKRSKTGRRILLRRRIKGRRQ
Subcellular Location(s) mito 17, nucl 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MQLLTARLARPLLSKPLSSAPRTLTTLAPLRPALFPFRQRAGNSPFALANPGFAPAVAATVPSDLVPCPAVSSHPALCGLQLRFGPRNTMNGHTRLVQKRRHGFLHRKRSKTGRRILLRRRIKGRRQLAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.37
4 0.41
5 0.39
6 0.39
7 0.35
8 0.36
9 0.38
10 0.37
11 0.29
12 0.29
13 0.33
14 0.3
15 0.29
16 0.25
17 0.24
18 0.24
19 0.24
20 0.25
21 0.24
22 0.28
23 0.3
24 0.32
25 0.36
26 0.35
27 0.4
28 0.41
29 0.43
30 0.39
31 0.35
32 0.32
33 0.27
34 0.29
35 0.22
36 0.17
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.05
43 0.06
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.04
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.1
60 0.1
61 0.1
62 0.11
63 0.11
64 0.11
65 0.15
66 0.14
67 0.14
68 0.15
69 0.18
70 0.2
71 0.21
72 0.26
73 0.22
74 0.27
75 0.27
76 0.32
77 0.31
78 0.31
79 0.32
80 0.31
81 0.38
82 0.42
83 0.46
84 0.47
85 0.53
86 0.59
87 0.62
88 0.66
89 0.67
90 0.69
91 0.73
92 0.78
93 0.78
94 0.75
95 0.76
96 0.79
97 0.81
98 0.79
99 0.79
100 0.78
101 0.79
102 0.84
103 0.88
104 0.88
105 0.87
106 0.87
107 0.87
108 0.87
109 0.87
110 0.87