Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A6K9

Protein Details
Accession T5A6K9   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
123-155AGSKTYRPGPCRTKRSPRRQEPWWEPRSRCRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPSKLVYGFRPEAFETWRLPDIDREFVRPEELEAFERALEAPDPLQTHAEEPVSVKSPRNGAGPHSRHITKRFSVAVGSFKDDASAVAAAARAVVGDSQPLQTLGSLTAGLKTQTGPAGQTPAGSKTYRPGPCRTKRSPRRQEPWWEPRSRCRLSDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.28
4 0.3
5 0.27
6 0.27
7 0.32
8 0.32
9 0.37
10 0.36
11 0.35
12 0.35
13 0.34
14 0.36
15 0.29
16 0.27
17 0.22
18 0.23
19 0.21
20 0.19
21 0.19
22 0.16
23 0.16
24 0.14
25 0.12
26 0.1
27 0.08
28 0.08
29 0.1
30 0.11
31 0.11
32 0.12
33 0.12
34 0.12
35 0.13
36 0.13
37 0.11
38 0.11
39 0.13
40 0.15
41 0.16
42 0.16
43 0.16
44 0.18
45 0.2
46 0.22
47 0.2
48 0.21
49 0.3
50 0.32
51 0.33
52 0.35
53 0.35
54 0.36
55 0.39
56 0.39
57 0.3
58 0.31
59 0.29
60 0.25
61 0.24
62 0.22
63 0.23
64 0.18
65 0.2
66 0.16
67 0.15
68 0.15
69 0.14
70 0.12
71 0.09
72 0.08
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.07
99 0.07
100 0.08
101 0.09
102 0.1
103 0.1
104 0.1
105 0.14
106 0.13
107 0.15
108 0.15
109 0.16
110 0.19
111 0.18
112 0.18
113 0.2
114 0.29
115 0.35
116 0.37
117 0.44
118 0.51
119 0.61
120 0.69
121 0.74
122 0.76
123 0.8
124 0.88
125 0.9
126 0.9
127 0.88
128 0.88
129 0.89
130 0.88
131 0.88
132 0.86
133 0.84
134 0.78
135 0.8
136 0.81
137 0.75