Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AEX3

Protein Details
Accession T5AEX3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-45ACNLSVGTRKRKARKPVESSSACRHydrophilic
NLS Segment(s)
PositionSequence
30-36RKRKARK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MSASKHAPGALQFSSSRSAGVACNLSVGTRKRKARKPVESSSACRGSRITALRTAERRPSARAQAGSIQNQWKIDHDLNVELARAAKQAGVGTFVFVSSGGTRGLVSSMAPYSKMKNGVEDVVRDLGFDQAVILKPGVILGQREQGRLVEGIAQTVARGLGKLGAGVQDMIGQDADVIARAAVRAAQLAAQGKAPSKYWVVEASEIVRLGRTEWPAAPAAAPEKPAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.16
5 0.17
6 0.14
7 0.18
8 0.18
9 0.14
10 0.15
11 0.15
12 0.15
13 0.2
14 0.24
15 0.29
16 0.36
17 0.45
18 0.53
19 0.62
20 0.73
21 0.77
22 0.83
23 0.82
24 0.83
25 0.84
26 0.8
27 0.77
28 0.74
29 0.72
30 0.61
31 0.53
32 0.44
33 0.37
34 0.37
35 0.36
36 0.31
37 0.28
38 0.32
39 0.37
40 0.4
41 0.42
42 0.42
43 0.43
44 0.43
45 0.42
46 0.44
47 0.45
48 0.47
49 0.44
50 0.4
51 0.41
52 0.44
53 0.42
54 0.41
55 0.37
56 0.34
57 0.34
58 0.32
59 0.26
60 0.27
61 0.25
62 0.23
63 0.21
64 0.2
65 0.21
66 0.2
67 0.18
68 0.13
69 0.12
70 0.1
71 0.08
72 0.07
73 0.06
74 0.06
75 0.07
76 0.07
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.07
83 0.06
84 0.07
85 0.05
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.09
100 0.11
101 0.15
102 0.14
103 0.15
104 0.17
105 0.18
106 0.18
107 0.17
108 0.17
109 0.15
110 0.14
111 0.13
112 0.12
113 0.09
114 0.08
115 0.07
116 0.06
117 0.05
118 0.06
119 0.07
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.06
126 0.07
127 0.07
128 0.14
129 0.15
130 0.16
131 0.16
132 0.16
133 0.16
134 0.15
135 0.14
136 0.12
137 0.11
138 0.11
139 0.11
140 0.1
141 0.08
142 0.09
143 0.09
144 0.04
145 0.05
146 0.04
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.08
159 0.06
160 0.06
161 0.06
162 0.06
163 0.04
164 0.04
165 0.03
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.07
174 0.1
175 0.13
176 0.13
177 0.15
178 0.16
179 0.18
180 0.19
181 0.19
182 0.19
183 0.19
184 0.19
185 0.2
186 0.23
187 0.23
188 0.24
189 0.24
190 0.23
191 0.24
192 0.23
193 0.21
194 0.18
195 0.15
196 0.15
197 0.19
198 0.19
199 0.2
200 0.2
201 0.23
202 0.24
203 0.24
204 0.22
205 0.2
206 0.21
207 0.2
208 0.2