Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T4ZXH9

Protein Details
Accession T4ZXH9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
113-132YDEAKDKKRRELMRQRTCGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, cysk 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029061  THDP-binding  
IPR045229  TPP_enz  
IPR011766  TPP_enzyme_TPP-bd  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030976  F:thiamine pyrophosphate binding  
Pfam View protein in Pfam  
PF02775  TPP_enzyme_C  
Amino Acid Sequences MTLTELATASQFNIGIKVIVLNNEEQGMVTQWQNLFYEDRYAHTHQVNPDFMKLAESMAVQCRRVSDPAEVVDSLKWLINTEGPALLEVVTDKKVPVLPMVPAGSALHEFLVYDEAKDKKRRELMRQRTCGLHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.11
5 0.1
6 0.12
7 0.13
8 0.13
9 0.13
10 0.14
11 0.13
12 0.11
13 0.11
14 0.1
15 0.11
16 0.1
17 0.12
18 0.12
19 0.14
20 0.14
21 0.15
22 0.15
23 0.14
24 0.19
25 0.16
26 0.19
27 0.23
28 0.24
29 0.27
30 0.27
31 0.3
32 0.28
33 0.33
34 0.33
35 0.28
36 0.27
37 0.24
38 0.22
39 0.2
40 0.16
41 0.11
42 0.09
43 0.08
44 0.09
45 0.13
46 0.15
47 0.14
48 0.14
49 0.16
50 0.16
51 0.18
52 0.18
53 0.14
54 0.14
55 0.15
56 0.16
57 0.14
58 0.13
59 0.12
60 0.11
61 0.1
62 0.08
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.07
80 0.08
81 0.1
82 0.1
83 0.12
84 0.12
85 0.12
86 0.16
87 0.17
88 0.15
89 0.15
90 0.14
91 0.13
92 0.13
93 0.12
94 0.08
95 0.07
96 0.07
97 0.07
98 0.1
99 0.09
100 0.09
101 0.14
102 0.18
103 0.25
104 0.33
105 0.35
106 0.41
107 0.5
108 0.57
109 0.63
110 0.71
111 0.76
112 0.79
113 0.84
114 0.78