Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5A8T2

Protein Details
Accession T5A8T2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-104KGAKKGAKKVGPKKVGPKKVGPKRNNBasic
NLS Segment(s)
PositionSequence
53-104NKKGGAAGAAGAKAAKAAVGNPKKGEKGAKKGAKKVGPKKVGPKKVGPKRNN
Subcellular Location(s) mito 9, cyto 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MKFTEVLAFVFAASSPLVSAAPSETGDLKETTFGLGARSFEAPGFIEARSPTNKKGGAAGAAGAKAAKAAVGNPKKGEKGAKKGAKKVGPKKVGPKKVGPKRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.08
10 0.09
11 0.1
12 0.11
13 0.13
14 0.13
15 0.12
16 0.11
17 0.11
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.1
27 0.09
28 0.1
29 0.09
30 0.09
31 0.1
32 0.08
33 0.09
34 0.09
35 0.12
36 0.15
37 0.16
38 0.17
39 0.2
40 0.21
41 0.2
42 0.21
43 0.19
44 0.16
45 0.15
46 0.14
47 0.11
48 0.1
49 0.1
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.03
56 0.05
57 0.15
58 0.2
59 0.23
60 0.25
61 0.28
62 0.29
63 0.32
64 0.39
65 0.37
66 0.42
67 0.5
68 0.56
69 0.6
70 0.66
71 0.73
72 0.72
73 0.74
74 0.75
75 0.75
76 0.75
77 0.75
78 0.78
79 0.8
80 0.82
81 0.77
82 0.78
83 0.78
84 0.81