Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A0S1

Protein Details
Accession T5A0S1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25DTPIINRNKEMRRKGNSSRRSSLHydrophilic
NLS Segment(s)
PositionSequence
14-28RRKGNSSRRSSLGSR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MSDTPIINRNKEMRRKGNSSRRSSLGSRGRRASSLIESGQTATPHREVDAAEFYKHIEAEGLPEPRRMKQLLMWCGERALAAKPPHGTPNSNAILGARAIQDQLLQDFASRSEFSNWFSRDDAVPEPRTVVRKPNPRNVELDEKMASLEGKIKRLQEDKKAWLAMRKPPPEQPPLFSPNETDTITLPDFDLLDPEEGKIRGYLADERNSFATVRSETEGRLRKIQASLEFEVDQLADNVHKLEQRVLVAGKEADRLLKASAVRLREREQRERTSAGTRDMPIMEVLRSLSSILPEGSGGEGMAASDSRASKPIQPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.82
4 0.84
5 0.84
6 0.84
7 0.8
8 0.74
9 0.71
10 0.66
11 0.65
12 0.64
13 0.64
14 0.62
15 0.62
16 0.61
17 0.56
18 0.55
19 0.5
20 0.45
21 0.41
22 0.35
23 0.3
24 0.28
25 0.29
26 0.29
27 0.25
28 0.22
29 0.2
30 0.21
31 0.2
32 0.2
33 0.19
34 0.17
35 0.2
36 0.27
37 0.25
38 0.23
39 0.23
40 0.23
41 0.23
42 0.22
43 0.18
44 0.11
45 0.09
46 0.13
47 0.19
48 0.23
49 0.22
50 0.27
51 0.29
52 0.3
53 0.35
54 0.31
55 0.27
56 0.28
57 0.36
58 0.39
59 0.42
60 0.41
61 0.37
62 0.36
63 0.34
64 0.29
65 0.21
66 0.16
67 0.18
68 0.17
69 0.2
70 0.22
71 0.23
72 0.28
73 0.3
74 0.3
75 0.25
76 0.33
77 0.32
78 0.3
79 0.28
80 0.23
81 0.21
82 0.19
83 0.18
84 0.1
85 0.08
86 0.08
87 0.08
88 0.09
89 0.08
90 0.09
91 0.08
92 0.07
93 0.07
94 0.08
95 0.08
96 0.1
97 0.1
98 0.11
99 0.14
100 0.15
101 0.18
102 0.25
103 0.26
104 0.25
105 0.25
106 0.25
107 0.21
108 0.23
109 0.24
110 0.22
111 0.22
112 0.2
113 0.21
114 0.22
115 0.25
116 0.24
117 0.29
118 0.31
119 0.4
120 0.46
121 0.53
122 0.56
123 0.54
124 0.57
125 0.52
126 0.53
127 0.44
128 0.41
129 0.32
130 0.27
131 0.25
132 0.22
133 0.17
134 0.09
135 0.14
136 0.13
137 0.15
138 0.17
139 0.18
140 0.22
141 0.28
142 0.32
143 0.34
144 0.38
145 0.39
146 0.41
147 0.42
148 0.39
149 0.37
150 0.37
151 0.37
152 0.4
153 0.4
154 0.39
155 0.43
156 0.47
157 0.49
158 0.47
159 0.41
160 0.38
161 0.4
162 0.39
163 0.33
164 0.3
165 0.25
166 0.27
167 0.24
168 0.19
169 0.14
170 0.16
171 0.16
172 0.14
173 0.12
174 0.1
175 0.1
176 0.09
177 0.09
178 0.06
179 0.07
180 0.07
181 0.07
182 0.09
183 0.09
184 0.09
185 0.09
186 0.08
187 0.08
188 0.1
189 0.16
190 0.18
191 0.23
192 0.24
193 0.25
194 0.25
195 0.26
196 0.24
197 0.18
198 0.18
199 0.13
200 0.15
201 0.16
202 0.15
203 0.15
204 0.23
205 0.3
206 0.29
207 0.33
208 0.32
209 0.33
210 0.35
211 0.38
212 0.36
213 0.35
214 0.34
215 0.32
216 0.31
217 0.28
218 0.25
219 0.21
220 0.16
221 0.1
222 0.09
223 0.06
224 0.06
225 0.07
226 0.08
227 0.1
228 0.1
229 0.13
230 0.15
231 0.16
232 0.18
233 0.18
234 0.17
235 0.17
236 0.18
237 0.16
238 0.16
239 0.15
240 0.14
241 0.14
242 0.15
243 0.13
244 0.15
245 0.15
246 0.19
247 0.23
248 0.27
249 0.3
250 0.34
251 0.38
252 0.44
253 0.51
254 0.55
255 0.59
256 0.61
257 0.62
258 0.61
259 0.59
260 0.58
261 0.54
262 0.49
263 0.46
264 0.39
265 0.38
266 0.35
267 0.32
268 0.26
269 0.24
270 0.19
271 0.15
272 0.15
273 0.12
274 0.12
275 0.12
276 0.11
277 0.11
278 0.12
279 0.11
280 0.11
281 0.1
282 0.11
283 0.11
284 0.1
285 0.08
286 0.07
287 0.06
288 0.06
289 0.07
290 0.06
291 0.05
292 0.09
293 0.11
294 0.12
295 0.15
296 0.17