Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A9G0

Protein Details
Accession T5A9G0   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-125IDTIREKRAKKVERERYEKMAETMHRKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
17-41KPLGMRKNGKQWHEPKKAFRPTAGL
43-121SYEKRTKERAAMAQMKAKEREIKAEKEAHRQGSRSRQQRIDTIREKRAKKVERERYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MATVNALVAESAAKPTKPLGMRKNGKQWHEPKKAFRPTAGLTSYEKRTKERAAMAQMKAKEREIKAEKEAHRQGSRSRQQRIDTIREKRAKKVERERYEKMAETMHRKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.21
4 0.26
5 0.34
6 0.38
7 0.47
8 0.55
9 0.62
10 0.71
11 0.71
12 0.7
13 0.71
14 0.72
15 0.72
16 0.75
17 0.73
18 0.72
19 0.75
20 0.8
21 0.72
22 0.63
23 0.58
24 0.5
25 0.51
26 0.44
27 0.36
28 0.3
29 0.33
30 0.37
31 0.35
32 0.34
33 0.3
34 0.33
35 0.33
36 0.34
37 0.35
38 0.34
39 0.38
40 0.43
41 0.43
42 0.43
43 0.43
44 0.42
45 0.38
46 0.34
47 0.31
48 0.25
49 0.32
50 0.31
51 0.31
52 0.32
53 0.38
54 0.39
55 0.42
56 0.46
57 0.44
58 0.41
59 0.4
60 0.42
61 0.45
62 0.51
63 0.49
64 0.51
65 0.51
66 0.52
67 0.57
68 0.58
69 0.57
70 0.57
71 0.57
72 0.6
73 0.63
74 0.62
75 0.63
76 0.67
77 0.65
78 0.67
79 0.71
80 0.72
81 0.74
82 0.8
83 0.78
84 0.75
85 0.72
86 0.64
87 0.54
88 0.5
89 0.45
90 0.47
91 0.49
92 0.51
93 0.53
94 0.53
95 0.59
96 0.63
97 0.68
98 0.69
99 0.73
100 0.76
101 0.79
102 0.89
103 0.92
104 0.93
105 0.93