Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5ADZ5

Protein Details
Accession T5ADZ5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MHHRRPGPSRRPGYRRRGTPKRNRSRTALAVBasic
NLS Segment(s)
PositionSequence
4-25RRPGPSRRPGYRRRGTPKRNRS
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MHHRRPGPSRRPGYRRRGTPKRNRSRTALAVNDEHNSTAVNDGHESPAATLSRTPMLGDQPGDVRTAYPERNPGWPKGAEADRPTESHSGPPTLLGPPGKGQLRLSRGPAPEYLLEPGGSPYFHYTSTGGARPSVVKKGASKAFKAIIEILSIGTGLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.88
5 0.89
6 0.9
7 0.92
8 0.92
9 0.93
10 0.87
11 0.84
12 0.81
13 0.78
14 0.76
15 0.7
16 0.62
17 0.56
18 0.52
19 0.47
20 0.39
21 0.31
22 0.22
23 0.17
24 0.13
25 0.13
26 0.12
27 0.11
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.1
34 0.13
35 0.12
36 0.11
37 0.11
38 0.11
39 0.12
40 0.12
41 0.12
42 0.1
43 0.12
44 0.13
45 0.13
46 0.12
47 0.12
48 0.13
49 0.13
50 0.12
51 0.1
52 0.11
53 0.14
54 0.14
55 0.13
56 0.18
57 0.18
58 0.26
59 0.28
60 0.27
61 0.28
62 0.27
63 0.26
64 0.26
65 0.27
66 0.22
67 0.21
68 0.23
69 0.21
70 0.21
71 0.23
72 0.2
73 0.18
74 0.19
75 0.19
76 0.16
77 0.15
78 0.15
79 0.14
80 0.12
81 0.14
82 0.12
83 0.11
84 0.11
85 0.16
86 0.17
87 0.17
88 0.18
89 0.22
90 0.27
91 0.29
92 0.31
93 0.33
94 0.33
95 0.33
96 0.32
97 0.29
98 0.25
99 0.24
100 0.21
101 0.16
102 0.15
103 0.13
104 0.14
105 0.12
106 0.11
107 0.1
108 0.12
109 0.13
110 0.13
111 0.14
112 0.13
113 0.16
114 0.2
115 0.22
116 0.19
117 0.18
118 0.2
119 0.22
120 0.25
121 0.28
122 0.26
123 0.27
124 0.29
125 0.37
126 0.44
127 0.44
128 0.43
129 0.43
130 0.45
131 0.43
132 0.42
133 0.36
134 0.29
135 0.26
136 0.24
137 0.19
138 0.13