Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AD88

Protein Details
Accession T5AD88   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-67LKKWGVRKYKRKVVVHNQNGRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MTKPFDSYRGEIVRLYIDENKTLEVVMDLMRARHCFTASRRSYMDNLKKWGVRKYKRKVVVHNQNGRGADGDADADDSQSPGQGGGDEFASLSTAAAPDETAPRPGAQSLTHGFPHDVELQHDHAPALHDHHGWGYFAHSSWPAEASLAPYAAAQYAAGSAPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.23
5 0.25
6 0.25
7 0.25
8 0.21
9 0.2
10 0.17
11 0.11
12 0.11
13 0.08
14 0.1
15 0.1
16 0.11
17 0.13
18 0.15
19 0.16
20 0.16
21 0.17
22 0.2
23 0.24
24 0.33
25 0.34
26 0.38
27 0.37
28 0.39
29 0.42
30 0.47
31 0.52
32 0.46
33 0.48
34 0.48
35 0.49
36 0.49
37 0.54
38 0.54
39 0.54
40 0.59
41 0.64
42 0.69
43 0.75
44 0.78
45 0.79
46 0.79
47 0.81
48 0.81
49 0.8
50 0.73
51 0.68
52 0.62
53 0.53
54 0.43
55 0.32
56 0.22
57 0.13
58 0.1
59 0.06
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.07
87 0.08
88 0.09
89 0.1
90 0.1
91 0.11
92 0.12
93 0.12
94 0.1
95 0.13
96 0.14
97 0.17
98 0.17
99 0.18
100 0.17
101 0.16
102 0.19
103 0.19
104 0.17
105 0.16
106 0.18
107 0.21
108 0.22
109 0.22
110 0.18
111 0.15
112 0.17
113 0.15
114 0.17
115 0.17
116 0.16
117 0.16
118 0.18
119 0.18
120 0.16
121 0.15
122 0.13
123 0.11
124 0.11
125 0.13
126 0.13
127 0.13
128 0.14
129 0.15
130 0.13
131 0.13
132 0.13
133 0.14
134 0.14
135 0.13
136 0.12
137 0.11
138 0.11
139 0.11
140 0.11
141 0.08
142 0.06
143 0.07