Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AJ52

Protein Details
Accession T5AJ52   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-131RGRPEPGRRLARRGRRRRHGSPGRAHGPSBasic
NLS Segment(s)
PositionSequence
84-133RAVAARRQRKGPHLAQVPARGRPEPGRRLARRGRRRRHGSPGRAHGPSRR
Subcellular Location(s) mito_nucl 9.166, nucl 9, mito 9, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014048  MethylDNA_cys_MeTrfase_DNA-bd  
IPR036217  MethylDNA_cys_MeTrfase_DNAb  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0006281  P:DNA repair  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF01035  DNA_binding_1  
Amino Acid Sequences MPRSDEAEAFFHAVYAAVQEIPHARVSSYGHIAMLVGTRKPHPPSATLAESKDVSLKSPAPSPGRPLHEAPLVGPGRPLQHPQRAVAARRQRKGPHLAQVPARGRPEPGRRLARRGRRRRHGSPGRAHGPSRRVRLVSQSTPVAGDAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.06
5 0.06
6 0.08
7 0.1
8 0.11
9 0.14
10 0.13
11 0.12
12 0.14
13 0.18
14 0.21
15 0.22
16 0.21
17 0.18
18 0.18
19 0.18
20 0.15
21 0.16
22 0.13
23 0.11
24 0.12
25 0.14
26 0.19
27 0.22
28 0.26
29 0.25
30 0.26
31 0.3
32 0.34
33 0.37
34 0.35
35 0.33
36 0.3
37 0.29
38 0.27
39 0.24
40 0.18
41 0.14
42 0.15
43 0.16
44 0.15
45 0.18
46 0.23
47 0.24
48 0.24
49 0.28
50 0.31
51 0.34
52 0.35
53 0.33
54 0.31
55 0.29
56 0.28
57 0.23
58 0.26
59 0.22
60 0.19
61 0.18
62 0.16
63 0.16
64 0.17
65 0.21
66 0.17
67 0.23
68 0.25
69 0.25
70 0.32
71 0.33
72 0.34
73 0.39
74 0.44
75 0.46
76 0.48
77 0.52
78 0.48
79 0.51
80 0.57
81 0.52
82 0.51
83 0.49
84 0.5
85 0.48
86 0.53
87 0.51
88 0.47
89 0.45
90 0.37
91 0.34
92 0.38
93 0.43
94 0.4
95 0.46
96 0.52
97 0.52
98 0.61
99 0.68
100 0.71
101 0.74
102 0.78
103 0.8
104 0.81
105 0.87
106 0.86
107 0.88
108 0.88
109 0.87
110 0.86
111 0.84
112 0.8
113 0.75
114 0.7
115 0.65
116 0.63
117 0.62
118 0.59
119 0.56
120 0.51
121 0.49
122 0.56
123 0.58
124 0.55
125 0.52
126 0.47
127 0.42
128 0.4