Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A8W4

Protein Details
Accession T5A8W4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-72QEMITHLPPRHRPRPRQRHPVHRARBasic
NLS Segment(s)
PositionSequence
56-72PRHRPRPRQRHPVHRAR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030374  PABS  
IPR029063  SAM-dependent_MTases_sf  
IPR001045  Spermi_synthase  
IPR035246  Spermidine_synt_N  
IPR037163  Spermidine_synt_N_sf  
Gene Ontology GO:0016740  F:transferase activity  
GO:0006596  P:polyamine biosynthetic process  
Pfam View protein in Pfam  
PF17284  Spermine_synt_N  
PROSITE View protein in PROSITE  
PS51006  PABS_2  
Amino Acid Sequences MTLKVEKVLHHEKSQYQDVLIFKSTHHGTVLVLDNVIQCTERDEFSYQEMITHLPPRHRPRPRQRHPVHRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.43
3 0.34
4 0.34
5 0.31
6 0.3
7 0.28
8 0.22
9 0.16
10 0.22
11 0.22
12 0.18
13 0.17
14 0.15
15 0.12
16 0.16
17 0.18
18 0.12
19 0.12
20 0.11
21 0.11
22 0.11
23 0.11
24 0.07
25 0.04
26 0.07
27 0.08
28 0.08
29 0.1
30 0.12
31 0.13
32 0.15
33 0.17
34 0.14
35 0.14
36 0.14
37 0.13
38 0.14
39 0.2
40 0.2
41 0.24
42 0.33
43 0.41
44 0.51
45 0.6
46 0.69
47 0.74
48 0.83
49 0.87
50 0.9
51 0.91
52 0.92