Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AH32

Protein Details
Accession T5AH32    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-33EAPPARRPQRPPPAARPQAHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 8, cysk 7, nucl 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037282  CapZ_alpha/beta  
IPR042276  CapZ_alpha/beta_2  
IPR001698  CAPZB  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008290  C:F-actin capping protein complex  
GO:0003779  F:actin binding  
GO:0051016  P:barbed-end actin filament capping  
Pfam View protein in Pfam  
PF01115  F_actin_cap_B  
Amino Acid Sequences MAAVAADPFDSALEAPPARRPQRPPPAARPQAHELAPQRHHLAGPGPDRGPALVGRPAADAAALQAHGARLPAGGVGSVYLWNLDDGFAGVVLLKKSATPGAPTEGVWDSIHVFEAIERGRTTHYKLTSTVILSLSTREGAIGDMDLSGNMTRQVEQDLPVESDDSHIANIGRLVEDMELKMRNLLQDVYFGKAKDVVGDLRSVGSLSEGAKDRETQRELIGSMKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.21
4 0.3
5 0.35
6 0.41
7 0.46
8 0.53
9 0.63
10 0.71
11 0.72
12 0.73
13 0.8
14 0.82
15 0.79
16 0.75
17 0.69
18 0.66
19 0.59
20 0.55
21 0.51
22 0.5
23 0.49
24 0.46
25 0.43
26 0.38
27 0.37
28 0.32
29 0.3
30 0.29
31 0.3
32 0.31
33 0.28
34 0.28
35 0.29
36 0.27
37 0.23
38 0.17
39 0.16
40 0.15
41 0.15
42 0.15
43 0.16
44 0.16
45 0.14
46 0.13
47 0.09
48 0.06
49 0.07
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.04
58 0.05
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.08
85 0.08
86 0.08
87 0.09
88 0.12
89 0.13
90 0.13
91 0.15
92 0.14
93 0.15
94 0.13
95 0.12
96 0.1
97 0.09
98 0.1
99 0.07
100 0.06
101 0.05
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.1
108 0.12
109 0.15
110 0.18
111 0.19
112 0.2
113 0.21
114 0.23
115 0.22
116 0.22
117 0.2
118 0.15
119 0.14
120 0.13
121 0.13
122 0.11
123 0.09
124 0.08
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.07
141 0.1
142 0.1
143 0.12
144 0.13
145 0.14
146 0.14
147 0.14
148 0.14
149 0.12
150 0.12
151 0.11
152 0.1
153 0.08
154 0.09
155 0.09
156 0.08
157 0.1
158 0.09
159 0.08
160 0.08
161 0.09
162 0.08
163 0.09
164 0.09
165 0.11
166 0.12
167 0.11
168 0.13
169 0.13
170 0.13
171 0.14
172 0.15
173 0.12
174 0.17
175 0.19
176 0.21
177 0.23
178 0.22
179 0.21
180 0.22
181 0.22
182 0.18
183 0.19
184 0.18
185 0.16
186 0.17
187 0.17
188 0.15
189 0.15
190 0.13
191 0.1
192 0.09
193 0.09
194 0.09
195 0.14
196 0.16
197 0.18
198 0.2
199 0.25
200 0.27
201 0.34
202 0.37
203 0.33
204 0.33
205 0.35
206 0.34