Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5ACF8

Protein Details
Accession T5ACF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-33LVNACRFWVRRQRTGRHRGDNMKPLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037221  H-type_lectin_dom_sf  
Gene Ontology GO:0030246  F:carbohydrate binding  
Amino Acid Sequences MAPNLASLVNACRFWVRRQRTGRHRGDNMKPLFGEGAPSRPESALADRHITGGPPSSPAPLPPLQTPSLSPPSPRTLRHPHSTTQDCPLITMEADTGPTDWAVYRIGQEIFRRHIPLIGRGDWLLKSDNMVFEVINEARPFNVLGIHPEAFVLALSRGPGTTEQDRLVRGVGHVAILEYRLTVEYPTGPELYLELHIRLKGRDIGSAIPVAYFEKWFPETSCLLPFRDGDLAKIDPHFHIVWRELFPDRDHMSGAYRTTLVPGKTRVCYVEFYQPFPMIPTVKLLLLSRNVPIWVTIRVQIETRDITQRGFSMCLSIAENEPIHRVVVGWEAMEPRVPQLPANPVPAYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.46
4 0.52
5 0.62
6 0.72
7 0.76
8 0.85
9 0.86
10 0.85
11 0.87
12 0.86
13 0.86
14 0.85
15 0.78
16 0.72
17 0.61
18 0.53
19 0.46
20 0.36
21 0.33
22 0.24
23 0.27
24 0.24
25 0.25
26 0.25
27 0.23
28 0.24
29 0.22
30 0.25
31 0.25
32 0.26
33 0.29
34 0.27
35 0.29
36 0.28
37 0.25
38 0.21
39 0.2
40 0.17
41 0.17
42 0.17
43 0.18
44 0.18
45 0.19
46 0.23
47 0.22
48 0.25
49 0.25
50 0.29
51 0.27
52 0.28
53 0.29
54 0.3
55 0.33
56 0.31
57 0.31
58 0.3
59 0.37
60 0.41
61 0.42
62 0.43
63 0.47
64 0.52
65 0.59
66 0.59
67 0.55
68 0.6
69 0.63
70 0.57
71 0.53
72 0.5
73 0.41
74 0.38
75 0.34
76 0.26
77 0.2
78 0.18
79 0.12
80 0.08
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.11
93 0.12
94 0.15
95 0.18
96 0.22
97 0.25
98 0.27
99 0.28
100 0.25
101 0.27
102 0.26
103 0.29
104 0.3
105 0.28
106 0.26
107 0.25
108 0.26
109 0.23
110 0.23
111 0.17
112 0.12
113 0.12
114 0.12
115 0.12
116 0.12
117 0.12
118 0.1
119 0.08
120 0.12
121 0.11
122 0.11
123 0.11
124 0.1
125 0.1
126 0.1
127 0.1
128 0.07
129 0.09
130 0.07
131 0.1
132 0.13
133 0.13
134 0.13
135 0.12
136 0.12
137 0.1
138 0.09
139 0.07
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.1
148 0.11
149 0.13
150 0.14
151 0.16
152 0.16
153 0.16
154 0.15
155 0.12
156 0.1
157 0.09
158 0.08
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.08
174 0.08
175 0.08
176 0.07
177 0.08
178 0.08
179 0.09
180 0.09
181 0.09
182 0.09
183 0.11
184 0.12
185 0.12
186 0.13
187 0.16
188 0.15
189 0.16
190 0.16
191 0.16
192 0.16
193 0.17
194 0.15
195 0.1
196 0.1
197 0.09
198 0.08
199 0.08
200 0.07
201 0.09
202 0.1
203 0.11
204 0.12
205 0.15
206 0.16
207 0.17
208 0.22
209 0.21
210 0.2
211 0.21
212 0.2
213 0.19
214 0.22
215 0.21
216 0.17
217 0.19
218 0.19
219 0.18
220 0.19
221 0.18
222 0.13
223 0.17
224 0.16
225 0.14
226 0.15
227 0.17
228 0.19
229 0.19
230 0.22
231 0.2
232 0.22
233 0.22
234 0.26
235 0.25
236 0.22
237 0.22
238 0.2
239 0.21
240 0.22
241 0.22
242 0.16
243 0.15
244 0.14
245 0.17
246 0.2
247 0.18
248 0.2
249 0.24
250 0.27
251 0.28
252 0.29
253 0.29
254 0.26
255 0.28
256 0.27
257 0.33
258 0.3
259 0.32
260 0.33
261 0.32
262 0.29
263 0.28
264 0.29
265 0.2
266 0.19
267 0.19
268 0.18
269 0.17
270 0.19
271 0.18
272 0.18
273 0.2
274 0.21
275 0.19
276 0.19
277 0.19
278 0.17
279 0.18
280 0.16
281 0.17
282 0.17
283 0.21
284 0.22
285 0.22
286 0.24
287 0.24
288 0.26
289 0.25
290 0.26
291 0.28
292 0.27
293 0.27
294 0.27
295 0.28
296 0.26
297 0.25
298 0.22
299 0.18
300 0.18
301 0.18
302 0.18
303 0.18
304 0.17
305 0.19
306 0.2
307 0.18
308 0.2
309 0.19
310 0.17
311 0.16
312 0.14
313 0.12
314 0.15
315 0.15
316 0.13
317 0.14
318 0.15
319 0.16
320 0.19
321 0.17
322 0.16
323 0.2
324 0.2
325 0.2
326 0.23
327 0.32
328 0.33
329 0.39