Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5ANT1

Protein Details
Accession T5ANT1    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-34QGNERVVEAKRRKKKEKKEEKKEGEWTRKKKBasic
NLS Segment(s)
PositionSequence
12-38AKRRKKKEKKEEKKEGEWTRKKKAERK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MRDQGNERVVEAKRRKKKEKKEEKKEGEWTRKKKAERKACKCTSDMSTDTWCGNTCRSDLILSLLGGEGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.75
3 0.79
4 0.88
5 0.89
6 0.91
7 0.92
8 0.93
9 0.95
10 0.92
11 0.89
12 0.88
13 0.86
14 0.85
15 0.83
16 0.78
17 0.76
18 0.75
19 0.73
20 0.7
21 0.71
22 0.71
23 0.72
24 0.76
25 0.77
26 0.77
27 0.74
28 0.67
29 0.61
30 0.53
31 0.48
32 0.4
33 0.33
34 0.29
35 0.27
36 0.27
37 0.24
38 0.22
39 0.17
40 0.18
41 0.17
42 0.15
43 0.15
44 0.16
45 0.16
46 0.16
47 0.18
48 0.18
49 0.16
50 0.16
51 0.14