Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5A164

Protein Details
Accession T5A164    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKTTSEKLYKDVQSYRLVTIATLVDRMKINGSPAGSASPTWRKRASSSRSLRTAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.89
8 0.85
9 0.81
10 0.72
11 0.64
12 0.54
13 0.49
14 0.4
15 0.34
16 0.27
17 0.2
18 0.19
19 0.16
20 0.16
21 0.12
22 0.12
23 0.13
24 0.19
25 0.2
26 0.23
27 0.24
28 0.26
29 0.29
30 0.3
31 0.28
32 0.23
33 0.21
34 0.17
35 0.15
36 0.13
37 0.09
38 0.1
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.13
46 0.13
47 0.14
48 0.12
49 0.13
50 0.14
51 0.13
52 0.13
53 0.17
54 0.25
55 0.28
56 0.33
57 0.35
58 0.36
59 0.43
60 0.52
61 0.54
62 0.55
63 0.62
64 0.65