Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U1G2P7

Protein Details
Accession U1G2P7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-88NGGITKKRGQKRQTRHQRLRQEKGLAHydrophilic
NLS Segment(s)
PositionSequence
68-86KKRGQKRQTRHQRLRQEKG
106-115RRVKVGRERR
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKTPKLKANPSSANPRSRASRRLATSLSTSAPALSSSDPTPNLTHPPPHLEKRNNNANAVLNGGITKKRGQKRQTRHQRLRQEKGLARAEDVLGKMEVKVERVVRRVKVGRERRRAWDEVNGDVDGVKKNAMGNAKDEEENKGEVKDGMDIEDEAEWVDENGTVEILGEEKEAEIFSIKSNVVPPEPEVDELENEEDKIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.63
4 0.62
5 0.59
6 0.6
7 0.56
8 0.58
9 0.55
10 0.58
11 0.56
12 0.5
13 0.48
14 0.44
15 0.38
16 0.3
17 0.26
18 0.2
19 0.18
20 0.15
21 0.13
22 0.11
23 0.12
24 0.12
25 0.16
26 0.17
27 0.19
28 0.2
29 0.2
30 0.25
31 0.25
32 0.27
33 0.26
34 0.33
35 0.37
36 0.42
37 0.49
38 0.52
39 0.58
40 0.62
41 0.7
42 0.64
43 0.59
44 0.55
45 0.48
46 0.4
47 0.34
48 0.26
49 0.16
50 0.14
51 0.14
52 0.12
53 0.11
54 0.15
55 0.22
56 0.29
57 0.37
58 0.45
59 0.54
60 0.63
61 0.73
62 0.8
63 0.83
64 0.86
65 0.87
66 0.89
67 0.89
68 0.87
69 0.82
70 0.78
71 0.7
72 0.67
73 0.64
74 0.53
75 0.44
76 0.37
77 0.31
78 0.25
79 0.22
80 0.15
81 0.09
82 0.09
83 0.08
84 0.1
85 0.09
86 0.09
87 0.11
88 0.14
89 0.16
90 0.2
91 0.24
92 0.23
93 0.29
94 0.31
95 0.34
96 0.41
97 0.49
98 0.55
99 0.61
100 0.64
101 0.65
102 0.67
103 0.64
104 0.56
105 0.53
106 0.45
107 0.38
108 0.37
109 0.29
110 0.23
111 0.21
112 0.2
113 0.13
114 0.11
115 0.09
116 0.07
117 0.07
118 0.11
119 0.15
120 0.14
121 0.16
122 0.19
123 0.21
124 0.22
125 0.22
126 0.23
127 0.2
128 0.22
129 0.19
130 0.17
131 0.15
132 0.14
133 0.14
134 0.14
135 0.12
136 0.11
137 0.11
138 0.11
139 0.11
140 0.1
141 0.09
142 0.07
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.07
163 0.07
164 0.09
165 0.12
166 0.12
167 0.13
168 0.17
169 0.19
170 0.19
171 0.21
172 0.21
173 0.23
174 0.25
175 0.25
176 0.24
177 0.23
178 0.23
179 0.24
180 0.26
181 0.21