Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GNV4

Protein Details
Accession U1GNV4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SGNIKTKTRNRSYPRSTVKKIHydrophilic
NLS Segment(s)
PositionSequence
74-91RKARASGEKRIAARDIRK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MSGNIKTKTRNRSYPRSTVKKIIKGHSEKKVGRNVDALVRTGHRLKVAQSLRSPQQVYVDYVLFIQELMRNASRKARASGEKRIAARDIRKVTMSSLRKFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.78
5 0.78
6 0.78
7 0.76
8 0.74
9 0.71
10 0.7
11 0.7
12 0.72
13 0.71
14 0.71
15 0.67
16 0.67
17 0.68
18 0.6
19 0.53
20 0.48
21 0.4
22 0.37
23 0.33
24 0.28
25 0.21
26 0.2
27 0.21
28 0.2
29 0.2
30 0.15
31 0.15
32 0.15
33 0.23
34 0.24
35 0.26
36 0.26
37 0.29
38 0.3
39 0.33
40 0.33
41 0.24
42 0.25
43 0.23
44 0.23
45 0.21
46 0.18
47 0.14
48 0.14
49 0.13
50 0.09
51 0.08
52 0.06
53 0.06
54 0.07
55 0.1
56 0.13
57 0.14
58 0.16
59 0.22
60 0.27
61 0.27
62 0.3
63 0.34
64 0.4
65 0.45
66 0.54
67 0.56
68 0.57
69 0.55
70 0.55
71 0.52
72 0.5
73 0.5
74 0.49
75 0.47
76 0.43
77 0.44
78 0.42
79 0.42
80 0.45
81 0.47
82 0.45