Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GSE8

Protein Details
Accession U1GSE8   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
11-39LLWKRPWRLSSPQKARQRKRLRLVDKVVDHydrophilic
74-96KYTIFDRKEKRYRKGIHSRGPGIBasic
NLS Segment(s)
PositionSequence
24-30KARQRKR
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MRASSPLLGGLLWKRPWRLSSPQKARQRKRLRLVDKVVDTLSAALQRNGAMSAKAIDRWYSEMPREEEMLPKDKYTIFDRKEKRYRKGIHSRGPGIQNSESRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.34
4 0.37
5 0.44
6 0.48
7 0.55
8 0.62
9 0.69
10 0.77
11 0.84
12 0.87
13 0.87
14 0.88
15 0.86
16 0.86
17 0.87
18 0.83
19 0.82
20 0.8
21 0.77
22 0.68
23 0.59
24 0.49
25 0.39
26 0.32
27 0.23
28 0.17
29 0.13
30 0.12
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.06
38 0.06
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.12
46 0.15
47 0.16
48 0.17
49 0.21
50 0.23
51 0.23
52 0.25
53 0.22
54 0.24
55 0.25
56 0.28
57 0.25
58 0.23
59 0.23
60 0.22
61 0.25
62 0.26
63 0.33
64 0.31
65 0.4
66 0.46
67 0.55
68 0.64
69 0.69
70 0.71
71 0.72
72 0.76
73 0.77
74 0.82
75 0.81
76 0.81
77 0.82
78 0.8
79 0.76
80 0.74
81 0.66
82 0.61
83 0.57