Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1HY79

Protein Details
Accession U1HY79   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-43EGPANHLTRRRQPGRRLPSLSRPRPNHydrophilic
64-83RPIPPRPRPHQPRTNTKVSEHydrophilic
NLS Segment(s)
PositionSequence
4-39RRRRIRSLLGVRSHEGPANHLTRRRQPGRRLPSLSR
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MSRRRRRIRSLLGVRSHEGPANHLTRRRQPGRRLPSLSRPRPNLGVRVQHRSVVHDGHTAHLQRPIPPRPRPHQPRTNTKVSEHPDDKVLANNPLLVSIYCETLRVYVKSYFLTSNQHADIPVGQWRIPKERIVFVNSGISHMDDHFWNTQNGRHPVDSNWGERFIVDPSDPFSGPVRPEVMHEVGSEKKKSEASENDKPFVSMNGLEGSWIPYGGEHAICPGRFLAKSAILLACALMVENFDMEILTGDIEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.65
3 0.57
4 0.49
5 0.38
6 0.33
7 0.32
8 0.33
9 0.36
10 0.39
11 0.43
12 0.49
13 0.6
14 0.66
15 0.67
16 0.72
17 0.78
18 0.81
19 0.85
20 0.82
21 0.78
22 0.79
23 0.82
24 0.81
25 0.79
26 0.75
27 0.69
28 0.7
29 0.67
30 0.63
31 0.59
32 0.59
33 0.55
34 0.58
35 0.55
36 0.52
37 0.49
38 0.46
39 0.43
40 0.35
41 0.32
42 0.29
43 0.28
44 0.25
45 0.3
46 0.27
47 0.24
48 0.27
49 0.26
50 0.28
51 0.35
52 0.42
53 0.46
54 0.51
55 0.58
56 0.59
57 0.69
58 0.73
59 0.75
60 0.75
61 0.75
62 0.79
63 0.77
64 0.8
65 0.72
66 0.64
67 0.63
68 0.58
69 0.59
70 0.5
71 0.44
72 0.37
73 0.36
74 0.34
75 0.29
76 0.26
77 0.2
78 0.18
79 0.18
80 0.16
81 0.14
82 0.14
83 0.1
84 0.11
85 0.09
86 0.11
87 0.09
88 0.1
89 0.1
90 0.11
91 0.13
92 0.11
93 0.14
94 0.14
95 0.15
96 0.15
97 0.17
98 0.16
99 0.15
100 0.19
101 0.18
102 0.19
103 0.18
104 0.18
105 0.16
106 0.16
107 0.15
108 0.11
109 0.13
110 0.11
111 0.11
112 0.13
113 0.15
114 0.19
115 0.2
116 0.22
117 0.21
118 0.24
119 0.25
120 0.27
121 0.26
122 0.22
123 0.25
124 0.22
125 0.21
126 0.17
127 0.15
128 0.12
129 0.11
130 0.12
131 0.07
132 0.1
133 0.11
134 0.12
135 0.13
136 0.13
137 0.16
138 0.23
139 0.27
140 0.27
141 0.26
142 0.26
143 0.26
144 0.34
145 0.33
146 0.29
147 0.26
148 0.25
149 0.24
150 0.22
151 0.22
152 0.15
153 0.14
154 0.11
155 0.09
156 0.11
157 0.14
158 0.14
159 0.14
160 0.14
161 0.15
162 0.16
163 0.18
164 0.17
165 0.15
166 0.17
167 0.2
168 0.2
169 0.18
170 0.18
171 0.19
172 0.22
173 0.26
174 0.26
175 0.22
176 0.23
177 0.25
178 0.26
179 0.31
180 0.35
181 0.4
182 0.49
183 0.52
184 0.52
185 0.49
186 0.48
187 0.41
188 0.32
189 0.26
190 0.17
191 0.14
192 0.13
193 0.13
194 0.13
195 0.13
196 0.14
197 0.11
198 0.11
199 0.09
200 0.07
201 0.09
202 0.11
203 0.11
204 0.08
205 0.12
206 0.16
207 0.16
208 0.18
209 0.17
210 0.19
211 0.19
212 0.21
213 0.22
214 0.21
215 0.22
216 0.24
217 0.24
218 0.2
219 0.2
220 0.18
221 0.13
222 0.09
223 0.08
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.06