Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GPK2

Protein Details
Accession U1GPK2   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
14-42KLKLKGVKDSRITKKRKNKTSKDEKSSGDBasic
NLS Segment(s)
PositionSequence
15-34LKLKGVKDSRITKKRKNKTS
63-71REEKKKKGK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSEDYTSTPSTGKLKLKGVKDSRITKKRKNKTSKDEKSSGDTVDDNSVILKKLEEEDLEIRREEKKKKGKSEELRDDDAEDPELGVRVKTEAERKYDEQRRKRLDDRLKREGVKTHKQRVEELNRYLSGLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.45
4 0.49
5 0.57
6 0.59
7 0.61
8 0.63
9 0.68
10 0.7
11 0.74
12 0.77
13 0.77
14 0.81
15 0.83
16 0.86
17 0.87
18 0.87
19 0.88
20 0.91
21 0.92
22 0.89
23 0.85
24 0.77
25 0.72
26 0.64
27 0.53
28 0.44
29 0.34
30 0.27
31 0.22
32 0.19
33 0.13
34 0.12
35 0.11
36 0.1
37 0.09
38 0.08
39 0.07
40 0.08
41 0.09
42 0.09
43 0.11
44 0.14
45 0.17
46 0.18
47 0.17
48 0.17
49 0.21
50 0.27
51 0.28
52 0.34
53 0.41
54 0.48
55 0.57
56 0.64
57 0.69
58 0.74
59 0.79
60 0.8
61 0.75
62 0.7
63 0.61
64 0.55
65 0.45
66 0.36
67 0.27
68 0.16
69 0.11
70 0.08
71 0.09
72 0.07
73 0.06
74 0.05
75 0.05
76 0.06
77 0.09
78 0.15
79 0.18
80 0.22
81 0.27
82 0.3
83 0.4
84 0.48
85 0.55
86 0.58
87 0.65
88 0.68
89 0.7
90 0.73
91 0.74
92 0.76
93 0.77
94 0.77
95 0.76
96 0.75
97 0.71
98 0.68
99 0.66
100 0.63
101 0.63
102 0.64
103 0.65
104 0.63
105 0.62
106 0.64
107 0.66
108 0.68
109 0.65
110 0.61
111 0.56
112 0.52
113 0.51
114 0.45
115 0.36
116 0.28
117 0.2
118 0.19
119 0.17
120 0.17
121 0.19
122 0.23
123 0.23