Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1G026

Protein Details
Accession U1G026    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-66QNQNQSQSQPQQKKEKKAKAPKPPSAPTSHydrophilic
NLS Segment(s)
PositionSequence
50-60KKEKKAKAPKP
Subcellular Location(s) cyto_nucl 13.833, cyto 12, nucl 11.5, mito_nucl 6.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
Amino Acid Sequences MEDLASRTDRASITEPPTTTEASKPQTANDTTSAPSTQNQNQSQSQPQQKKEKKAKAPKPPSAPTSLPLSPALIDLRVGHILRCIPHENADSLYVSTIAMGDAEGTDNTHKDEETGRVVRTVCSGLRGLIPIEQMQDRKVIVMANLKPVTMRGIKSAAMVLAASPPPKEGEDAHAADRVVELVAPPDGSEGGAKVYFEGWEYGEGKGPEKVLNPKKKQWESIQPGLYTSEDLAVVFDAARVQGVEGGTGELVVEGVEGKCKVPSLKGARLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.36
5 0.35
6 0.33
7 0.3
8 0.32
9 0.31
10 0.37
11 0.34
12 0.35
13 0.4
14 0.39
15 0.39
16 0.34
17 0.32
18 0.27
19 0.29
20 0.28
21 0.22
22 0.22
23 0.25
24 0.29
25 0.36
26 0.38
27 0.41
28 0.44
29 0.47
30 0.52
31 0.55
32 0.59
33 0.58
34 0.62
35 0.68
36 0.71
37 0.78
38 0.81
39 0.82
40 0.82
41 0.85
42 0.88
43 0.88
44 0.9
45 0.88
46 0.87
47 0.83
48 0.75
49 0.71
50 0.63
51 0.53
52 0.5
53 0.42
54 0.35
55 0.29
56 0.26
57 0.19
58 0.19
59 0.18
60 0.11
61 0.11
62 0.09
63 0.11
64 0.13
65 0.13
66 0.11
67 0.13
68 0.14
69 0.15
70 0.18
71 0.19
72 0.17
73 0.21
74 0.22
75 0.21
76 0.21
77 0.21
78 0.18
79 0.15
80 0.14
81 0.1
82 0.08
83 0.07
84 0.06
85 0.05
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.09
100 0.11
101 0.16
102 0.18
103 0.17
104 0.19
105 0.2
106 0.19
107 0.19
108 0.18
109 0.12
110 0.12
111 0.12
112 0.1
113 0.11
114 0.11
115 0.1
116 0.09
117 0.1
118 0.08
119 0.09
120 0.1
121 0.1
122 0.1
123 0.11
124 0.1
125 0.09
126 0.09
127 0.08
128 0.08
129 0.14
130 0.14
131 0.2
132 0.2
133 0.2
134 0.19
135 0.19
136 0.21
137 0.17
138 0.17
139 0.12
140 0.14
141 0.14
142 0.15
143 0.15
144 0.11
145 0.09
146 0.08
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.08
154 0.09
155 0.1
156 0.09
157 0.13
158 0.18
159 0.2
160 0.2
161 0.21
162 0.21
163 0.19
164 0.18
165 0.14
166 0.09
167 0.07
168 0.06
169 0.04
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.07
181 0.07
182 0.07
183 0.07
184 0.08
185 0.08
186 0.07
187 0.1
188 0.12
189 0.12
190 0.16
191 0.16
192 0.17
193 0.17
194 0.18
195 0.16
196 0.19
197 0.29
198 0.35
199 0.45
200 0.5
201 0.57
202 0.66
203 0.7
204 0.72
205 0.7
206 0.72
207 0.7
208 0.72
209 0.69
210 0.59
211 0.55
212 0.5
213 0.42
214 0.32
215 0.24
216 0.16
217 0.11
218 0.1
219 0.1
220 0.08
221 0.08
222 0.07
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.08
230 0.08
231 0.08
232 0.08
233 0.09
234 0.08
235 0.08
236 0.08
237 0.05
238 0.05
239 0.04
240 0.04
241 0.05
242 0.05
243 0.09
244 0.09
245 0.1
246 0.11
247 0.14
248 0.16
249 0.18
250 0.28
251 0.33