Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GIX4

Protein Details
Accession U1GIX4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
318-338LRAVRRWFGRREERGRNVRMEBasic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MAGELTYRDIMMLWYYGVKPSWVIAVVATFLFSCTTLVHLLILFRQQAFFAFPLLAGSLFEVVGYGFRAAGLHEDIPDPSTYVTYSTLITLAPGFIAASLYQLLAHIILANGRGGRTQLITKLGLGCGFGILDVLGYALQAAGMSKLQTGPFGHSPANELLQHVRSLLLAGNIITLINLTLFTALTIYYLTVLLLRCGCTSSSSSSSSDPGLISHTPFTILLLSLGLLFIRTIYRTVAASKGLVDEWGKDAAVYPLRVTPLFSERWNYGFDAFMVFVLVVVWAAWFPTRDRLGEDDEVGTGMQSSAGVWAASWTGGLLRAVRRWFGRREERGRNVRMEGFSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.15
6 0.13
7 0.14
8 0.16
9 0.14
10 0.13
11 0.11
12 0.11
13 0.12
14 0.11
15 0.11
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.12
29 0.15
30 0.15
31 0.14
32 0.14
33 0.13
34 0.14
35 0.16
36 0.15
37 0.13
38 0.11
39 0.1
40 0.11
41 0.11
42 0.1
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.06
57 0.08
58 0.1
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.13
65 0.12
66 0.09
67 0.09
68 0.09
69 0.09
70 0.11
71 0.1
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.08
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.05
92 0.05
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.09
104 0.1
105 0.11
106 0.14
107 0.14
108 0.15
109 0.16
110 0.15
111 0.14
112 0.12
113 0.1
114 0.07
115 0.06
116 0.05
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.03
130 0.04
131 0.04
132 0.04
133 0.06
134 0.06
135 0.08
136 0.09
137 0.12
138 0.13
139 0.15
140 0.15
141 0.14
142 0.17
143 0.16
144 0.18
145 0.14
146 0.13
147 0.13
148 0.14
149 0.14
150 0.11
151 0.1
152 0.08
153 0.08
154 0.08
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.05
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.1
188 0.13
189 0.16
190 0.17
191 0.19
192 0.19
193 0.2
194 0.18
195 0.18
196 0.14
197 0.11
198 0.12
199 0.11
200 0.11
201 0.11
202 0.11
203 0.1
204 0.1
205 0.1
206 0.08
207 0.07
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.04
214 0.04
215 0.03
216 0.04
217 0.04
218 0.05
219 0.06
220 0.06
221 0.08
222 0.09
223 0.1
224 0.12
225 0.12
226 0.12
227 0.11
228 0.12
229 0.11
230 0.12
231 0.11
232 0.1
233 0.11
234 0.12
235 0.11
236 0.1
237 0.1
238 0.12
239 0.15
240 0.14
241 0.13
242 0.15
243 0.17
244 0.17
245 0.17
246 0.16
247 0.17
248 0.2
249 0.2
250 0.21
251 0.21
252 0.23
253 0.24
254 0.22
255 0.18
256 0.17
257 0.16
258 0.14
259 0.13
260 0.11
261 0.1
262 0.08
263 0.07
264 0.06
265 0.06
266 0.04
267 0.03
268 0.04
269 0.03
270 0.04
271 0.05
272 0.06
273 0.08
274 0.15
275 0.17
276 0.18
277 0.21
278 0.24
279 0.29
280 0.31
281 0.31
282 0.24
283 0.22
284 0.22
285 0.19
286 0.15
287 0.09
288 0.07
289 0.06
290 0.05
291 0.05
292 0.05
293 0.06
294 0.06
295 0.05
296 0.06
297 0.07
298 0.07
299 0.06
300 0.06
301 0.06
302 0.07
303 0.09
304 0.12
305 0.15
306 0.2
307 0.23
308 0.27
309 0.32
310 0.37
311 0.42
312 0.49
313 0.56
314 0.61
315 0.69
316 0.75
317 0.8
318 0.83
319 0.82
320 0.78
321 0.72
322 0.68
323 0.63