Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U1GHB4

Protein Details
Accession U1GHB4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-87RAWLAEKRRKRYLKQQKRLGSDKKPMGBasic
NLS Segment(s)
PositionSequence
66-93EKRRKRYLKQQKRLGSDKKPMGKGSRQG
Subcellular Location(s) plas 16, mito 7, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIFLPSAAIATIFSMSSSFDKSHQNELLVSSEFWIFWSVAIPLTAVVLVIYALWAQRAGVRAWLAEKRRKRYLKQQKRLGSDKKPMGKGSRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.09
4 0.12
5 0.12
6 0.14
7 0.22
8 0.24
9 0.31
10 0.31
11 0.31
12 0.29
13 0.29
14 0.3
15 0.23
16 0.2
17 0.14
18 0.13
19 0.11
20 0.11
21 0.11
22 0.08
23 0.07
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.04
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.03
43 0.05
44 0.07
45 0.07
46 0.09
47 0.1
48 0.1
49 0.13
50 0.19
51 0.24
52 0.31
53 0.38
54 0.43
55 0.53
56 0.6
57 0.63
58 0.69
59 0.75
60 0.78
61 0.81
62 0.84
63 0.82
64 0.84
65 0.87
66 0.85
67 0.82
68 0.81
69 0.79
70 0.78
71 0.74
72 0.72
73 0.7