Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AQH7

Protein Details
Accession B2AQH7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-67EWLPKWVGRRWRKSKAVRSGRKYHydrophilic
NLS Segment(s)
PositionSequence
52-66GRRWRKSKAVRSGRK
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
KEGG pan:PODANSg2766  -  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences MDHTSNRAKLRAVIAALQFRSWHGEGWRRVVVLTDLEYIVKGATEWLPKWVGRRWRKSKAVRSGRKYANRDLWGELQHRIEELGGEGCEVSLWLVRDGELIRQTKAAARLAAWEGKKEGLPVERFTRLFGIMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.31
5 0.28
6 0.24
7 0.28
8 0.24
9 0.22
10 0.21
11 0.29
12 0.31
13 0.37
14 0.38
15 0.32
16 0.31
17 0.3
18 0.26
19 0.2
20 0.19
21 0.14
22 0.12
23 0.12
24 0.12
25 0.11
26 0.09
27 0.07
28 0.05
29 0.05
30 0.07
31 0.1
32 0.1
33 0.13
34 0.15
35 0.16
36 0.19
37 0.24
38 0.31
39 0.38
40 0.48
41 0.54
42 0.62
43 0.71
44 0.77
45 0.81
46 0.82
47 0.84
48 0.82
49 0.79
50 0.79
51 0.78
52 0.77
53 0.71
54 0.65
55 0.62
56 0.56
57 0.51
58 0.45
59 0.39
60 0.35
61 0.32
62 0.29
63 0.22
64 0.2
65 0.18
66 0.15
67 0.13
68 0.09
69 0.08
70 0.07
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.06
80 0.07
81 0.07
82 0.07
83 0.09
84 0.1
85 0.13
86 0.17
87 0.18
88 0.18
89 0.19
90 0.19
91 0.21
92 0.25
93 0.24
94 0.19
95 0.18
96 0.21
97 0.24
98 0.29
99 0.26
100 0.25
101 0.23
102 0.24
103 0.24
104 0.22
105 0.22
106 0.24
107 0.26
108 0.29
109 0.33
110 0.38
111 0.37
112 0.39
113 0.37