Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GQS9

Protein Details
Accession U1GQS9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-55EKRIMRGSSLRERRRRRRVEAHQEVVBasic
NLS Segment(s)
PositionSequence
36-47GSSLRERRRRRR
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MAIQSTLPSMASTPAIWPRVPKRCASLTTEKRIMRGSSLRERRRRRRVEAHQEVVPAVVVGLMRFGGAGQEEGPPVIETPDHARGPQDYRAGVAGDSGGREGDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.26
5 0.33
6 0.42
7 0.44
8 0.43
9 0.43
10 0.46
11 0.49
12 0.5
13 0.52
14 0.51
15 0.56
16 0.62
17 0.56
18 0.52
19 0.52
20 0.45
21 0.39
22 0.36
23 0.34
24 0.37
25 0.47
26 0.54
27 0.6
28 0.7
29 0.76
30 0.82
31 0.83
32 0.81
33 0.82
34 0.84
35 0.85
36 0.84
37 0.77
38 0.68
39 0.6
40 0.51
41 0.4
42 0.29
43 0.18
44 0.09
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.13
67 0.19
68 0.19
69 0.19
70 0.21
71 0.24
72 0.28
73 0.33
74 0.3
75 0.24
76 0.25
77 0.26
78 0.25
79 0.22
80 0.18
81 0.13
82 0.11
83 0.11
84 0.1