Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GEB5

Protein Details
Accession U1GEB5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPASKRKRGGQKATSKRAAKNTHydrophilic
NLS Segment(s)
PositionSequence
5-21KRKRGGQKATSKRAAKN
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010760  DNA-repair_Swi5  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF07061  Swi5  
Amino Acid Sequences MPASKRKRGGQKATSKRAAKNTAKPETPADPEPDLQRTQPSTYTVESLPEENAAADPAAESAPSPRILAPLTQLKSSTPNADLTSSPSIPKSPTPSSPDAKTASQGPGSAAPDHPILPPSSPSTYQPHSASPSAPQPPTSNPSSANLLRTKISTLQSQTSTLQTQLSSTYAQLAAKTTPAPESDPAAKAEAILKRHIRLLHEYNEIRDVGMGLMGLIADARGVRLGEVMDGFGVGADGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.84
3 0.81
4 0.79
5 0.79
6 0.77
7 0.76
8 0.76
9 0.75
10 0.71
11 0.67
12 0.63
13 0.58
14 0.55
15 0.48
16 0.43
17 0.38
18 0.38
19 0.39
20 0.38
21 0.34
22 0.3
23 0.32
24 0.3
25 0.29
26 0.29
27 0.29
28 0.28
29 0.28
30 0.29
31 0.24
32 0.24
33 0.23
34 0.21
35 0.18
36 0.15
37 0.14
38 0.12
39 0.11
40 0.09
41 0.07
42 0.06
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.09
50 0.09
51 0.1
52 0.1
53 0.11
54 0.12
55 0.13
56 0.15
57 0.21
58 0.22
59 0.22
60 0.22
61 0.22
62 0.25
63 0.26
64 0.25
65 0.18
66 0.19
67 0.19
68 0.2
69 0.2
70 0.2
71 0.23
72 0.2
73 0.2
74 0.18
75 0.18
76 0.18
77 0.2
78 0.22
79 0.21
80 0.25
81 0.31
82 0.35
83 0.38
84 0.38
85 0.39
86 0.36
87 0.33
88 0.29
89 0.26
90 0.22
91 0.19
92 0.18
93 0.15
94 0.15
95 0.16
96 0.16
97 0.13
98 0.13
99 0.13
100 0.13
101 0.13
102 0.1
103 0.1
104 0.09
105 0.1
106 0.11
107 0.13
108 0.13
109 0.15
110 0.19
111 0.2
112 0.23
113 0.23
114 0.22
115 0.24
116 0.24
117 0.22
118 0.19
119 0.23
120 0.24
121 0.23
122 0.22
123 0.21
124 0.23
125 0.27
126 0.27
127 0.22
128 0.19
129 0.21
130 0.25
131 0.24
132 0.26
133 0.24
134 0.23
135 0.22
136 0.22
137 0.21
138 0.2
139 0.22
140 0.21
141 0.22
142 0.24
143 0.25
144 0.26
145 0.26
146 0.24
147 0.23
148 0.2
149 0.18
150 0.14
151 0.13
152 0.12
153 0.12
154 0.1
155 0.1
156 0.11
157 0.11
158 0.11
159 0.11
160 0.12
161 0.11
162 0.12
163 0.12
164 0.11
165 0.11
166 0.12
167 0.14
168 0.14
169 0.18
170 0.2
171 0.21
172 0.22
173 0.22
174 0.21
175 0.19
176 0.23
177 0.23
178 0.21
179 0.27
180 0.28
181 0.28
182 0.32
183 0.34
184 0.32
185 0.36
186 0.4
187 0.39
188 0.45
189 0.45
190 0.42
191 0.43
192 0.39
193 0.31
194 0.26
195 0.2
196 0.12
197 0.11
198 0.08
199 0.05
200 0.05
201 0.05
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.04
208 0.05
209 0.06
210 0.06
211 0.07
212 0.08
213 0.09
214 0.09
215 0.09
216 0.08
217 0.08
218 0.07
219 0.06