Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1HUQ3

Protein Details
Accession U1HUQ3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFARHQSDRFMCVPTNWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFARHQSDRFMCVPTNWRKPKGIDNRVRRRFKGQAVMPSIGFGSNKKTRHMMPSGHKAFLVHNPKDVDLLLMHNRTYAAEIAHAVSSRKRVEILAKAKSLGVKVTNGRARVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.87
5 0.87
6 0.88
7 0.88
8 0.87
9 0.86
10 0.81
11 0.75
12 0.66
13 0.57
14 0.47
15 0.39
16 0.42
17 0.4
18 0.47
19 0.48
20 0.51
21 0.51
22 0.54
23 0.61
24 0.63
25 0.65
26 0.64
27 0.68
28 0.75
29 0.82
30 0.85
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.32
62 0.35
63 0.36
64 0.26
65 0.28
66 0.29
67 0.29
68 0.29
69 0.27
70 0.2
71 0.12
72 0.15
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.38
97 0.4
98 0.4
99 0.4
100 0.4
101 0.4
102 0.35
103 0.29
104 0.24
105 0.23
106 0.26
107 0.35
108 0.38
109 0.38
110 0.39
111 0.36