Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1G7S2

Protein Details
Accession U1G7S2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKVTPKAGCKRKRAPSPVNERPKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
CDD cd09917  F-box_SF  
Amino Acid Sequences MKVTPKAGCKRKRAPSPVNERPKFLRFPPAMLAYDPTRRITRNTKKINDHNKEPMLLNMPTEVILQISENLDVLDRAALALSCKGLAAKLNAHNHLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.86
4 0.87
5 0.88
6 0.79
7 0.73
8 0.69
9 0.64
10 0.58
11 0.5
12 0.49
13 0.39
14 0.4
15 0.4
16 0.38
17 0.34
18 0.31
19 0.31
20 0.24
21 0.28
22 0.26
23 0.24
24 0.22
25 0.22
26 0.26
27 0.34
28 0.42
29 0.47
30 0.55
31 0.59
32 0.65
33 0.74
34 0.8
35 0.74
36 0.69
37 0.66
38 0.58
39 0.53
40 0.45
41 0.37
42 0.3
43 0.25
44 0.2
45 0.14
46 0.13
47 0.11
48 0.11
49 0.1
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.11
74 0.13
75 0.19
76 0.27
77 0.34