Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GB98

Protein Details
Accession U1GB98    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-139NGGDPHRQRKRHPRGGRDQIRRQRHPIRHHGRHGQCRLPLBasic
NLS Segment(s)
PositionSequence
104-131PHRQRKRHPRGGRDQIRRQRHPIRHHGR
Subcellular Location(s) cyto_nucl 15.5, nucl 13.5, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036393  AceGlu_kinase-like_sf  
Amino Acid Sequences MSDLKGSKMKGPKQLTIVIKLGTSSIVDEITHQPILSVLSLIAETAIKLIKDGHKVIIVSSGAIGMGLRRMDIEKKPQYLPRLQDPIRERKEHAVGTPQNGGDPHRQRKRHPRGGRDQIRRQRHPIRHHGRHGQCRLPLPDDGRRLPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.58
3 0.54
4 0.51
5 0.42
6 0.36
7 0.31
8 0.26
9 0.19
10 0.15
11 0.11
12 0.08
13 0.08
14 0.08
15 0.11
16 0.13
17 0.16
18 0.16
19 0.15
20 0.14
21 0.13
22 0.15
23 0.12
24 0.09
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.04
31 0.04
32 0.05
33 0.06
34 0.05
35 0.06
36 0.09
37 0.12
38 0.16
39 0.17
40 0.18
41 0.19
42 0.19
43 0.19
44 0.2
45 0.16
46 0.12
47 0.11
48 0.1
49 0.07
50 0.07
51 0.07
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.06
58 0.09
59 0.11
60 0.2
61 0.23
62 0.26
63 0.28
64 0.32
65 0.35
66 0.37
67 0.38
68 0.37
69 0.41
70 0.38
71 0.43
72 0.44
73 0.51
74 0.51
75 0.49
76 0.44
77 0.41
78 0.46
79 0.4
80 0.36
81 0.36
82 0.32
83 0.33
84 0.34
85 0.29
86 0.25
87 0.24
88 0.26
89 0.26
90 0.32
91 0.4
92 0.45
93 0.5
94 0.57
95 0.68
96 0.76
97 0.78
98 0.79
99 0.79
100 0.81
101 0.88
102 0.9
103 0.89
104 0.89
105 0.87
106 0.89
107 0.84
108 0.82
109 0.82
110 0.8
111 0.8
112 0.8
113 0.81
114 0.81
115 0.84
116 0.86
117 0.85
118 0.87
119 0.84
120 0.8
121 0.74
122 0.72
123 0.68
124 0.61
125 0.56
126 0.52
127 0.52
128 0.53