Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1HM49

Protein Details
Accession U1HM49    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
114-135SLPNIMKAKKKKIEKKTLEDYGHydrophilic
NLS Segment(s)
PositionSequence
120-129KAKKKKIEKK
139-146RRRLKTVK
150-154PPPRK
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014730  ETF_a/b_N  
IPR012255  ETF_b  
IPR033948  ETF_beta_N  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0009055  F:electron transfer activity  
Pfam View protein in Pfam  
PF01012  ETF  
CDD cd01714  ETF_beta  
Amino Acid Sequences MAMGADRAIHVEVPDDHPPEPLGVAKLLKAVAEKEESNLVMVGKQAIDDDSGQTGQMLAGLLGWPQATQASKVEIEGETVTVTKEVDGGVDTVRARLPMVITTDLRLNEPRYASLPNIMKAKKKKIEKKTLEDYGVDARRRLKTVKVEEPPPRKGGGKVQDVDGMISKLKELGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.25
5 0.25
6 0.22
7 0.21
8 0.18
9 0.14
10 0.14
11 0.14
12 0.14
13 0.15
14 0.15
15 0.14
16 0.14
17 0.13
18 0.14
19 0.17
20 0.17
21 0.16
22 0.19
23 0.18
24 0.17
25 0.17
26 0.14
27 0.11
28 0.11
29 0.1
30 0.07
31 0.07
32 0.07
33 0.06
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.06
43 0.07
44 0.06
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.07
56 0.08
57 0.1
58 0.1
59 0.1
60 0.11
61 0.1
62 0.1
63 0.09
64 0.09
65 0.07
66 0.07
67 0.07
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.1
87 0.11
88 0.11
89 0.12
90 0.15
91 0.15
92 0.16
93 0.16
94 0.16
95 0.16
96 0.17
97 0.17
98 0.16
99 0.18
100 0.17
101 0.21
102 0.22
103 0.22
104 0.28
105 0.29
106 0.35
107 0.4
108 0.49
109 0.51
110 0.58
111 0.65
112 0.69
113 0.79
114 0.8
115 0.82
116 0.81
117 0.79
118 0.71
119 0.62
120 0.54
121 0.51
122 0.49
123 0.41
124 0.34
125 0.33
126 0.34
127 0.37
128 0.37
129 0.35
130 0.38
131 0.46
132 0.54
133 0.55
134 0.6
135 0.67
136 0.73
137 0.71
138 0.63
139 0.58
140 0.5
141 0.47
142 0.48
143 0.47
144 0.48
145 0.45
146 0.45
147 0.46
148 0.44
149 0.42
150 0.35
151 0.27
152 0.2
153 0.18
154 0.16
155 0.13