Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1I023

Protein Details
Accession U1I023    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-125LDLRPKQTRAIRRRLTKKEKGLVTEKQRKKQMHFPMRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
78-114KKKYLPLDLRPKQTRAIRRRLTKKEKGLVTEKQRKKQ
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSAKVKTGQLWGKGKDDLKKQLEELKTELGQLRVQKIAGGASSKLTRIHDLRKSIAKVLTVINANQRSQLRLFYKKKKYLPLDLRPKQTRAIRRRLTKKEKGLVTEKQRKKQMHFPMRKYAVKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.53
4 0.5
5 0.52
6 0.53
7 0.51
8 0.5
9 0.49
10 0.51
11 0.49
12 0.45
13 0.41
14 0.36
15 0.31
16 0.31
17 0.3
18 0.24
19 0.24
20 0.24
21 0.23
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.12
29 0.1
30 0.11
31 0.12
32 0.13
33 0.14
34 0.15
35 0.18
36 0.19
37 0.26
38 0.29
39 0.31
40 0.34
41 0.37
42 0.37
43 0.36
44 0.35
45 0.28
46 0.24
47 0.21
48 0.21
49 0.16
50 0.15
51 0.18
52 0.19
53 0.18
54 0.21
55 0.2
56 0.19
57 0.19
58 0.24
59 0.23
60 0.32
61 0.39
62 0.45
63 0.55
64 0.61
65 0.65
66 0.68
67 0.69
68 0.69
69 0.71
70 0.72
71 0.73
72 0.72
73 0.77
74 0.71
75 0.68
76 0.65
77 0.62
78 0.62
79 0.59
80 0.64
81 0.63
82 0.69
83 0.78
84 0.82
85 0.85
86 0.84
87 0.85
88 0.83
89 0.79
90 0.75
91 0.71
92 0.7
93 0.7
94 0.72
95 0.71
96 0.71
97 0.75
98 0.74
99 0.74
100 0.74
101 0.75
102 0.75
103 0.77
104 0.75
105 0.78
106 0.8
107 0.78
108 0.73