Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1G9S7

Protein Details
Accession U1G9S7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-27DESPAQRQARIRREKREAKIKAGHydrophilic
NLS Segment(s)
PositionSequence
13-30ARIRREKREAKIKAGGSE
Subcellular Location(s) nucl 7mito 7mito_nucl 7, plas 6, cyto_nucl 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSEADESPAQRQARIRREKREAKIKAGGSERLEKITKLSGRTPEMMRNSSPSPSASPAPQSQTPPITSQPSDPSQIRAQEEFLRSMLRAQDPQQPGQATDQQQQQMPEDPMMKLLSSLAGGENNMDPNNPTGLPFSPEDIQSATGMPSWATSLLMGGKGKVPPTVEERKIATIWNIVHVMFSILAGAYLLFVLGGATKKFGKEPPPPATAKNPFLAFALGELLIHTSRVLTKDPASTQRGNGWLQILKDVARDGSIVLFMLGAANWWNGTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.67
4 0.77
5 0.84
6 0.86
7 0.87
8 0.82
9 0.79
10 0.79
11 0.72
12 0.69
13 0.64
14 0.59
15 0.53
16 0.55
17 0.49
18 0.45
19 0.43
20 0.36
21 0.34
22 0.37
23 0.36
24 0.32
25 0.36
26 0.38
27 0.41
28 0.45
29 0.45
30 0.45
31 0.47
32 0.46
33 0.42
34 0.4
35 0.38
36 0.35
37 0.33
38 0.28
39 0.25
40 0.25
41 0.26
42 0.23
43 0.26
44 0.28
45 0.31
46 0.33
47 0.33
48 0.34
49 0.35
50 0.35
51 0.33
52 0.33
53 0.33
54 0.3
55 0.3
56 0.31
57 0.3
58 0.33
59 0.31
60 0.31
61 0.3
62 0.34
63 0.34
64 0.29
65 0.3
66 0.3
67 0.32
68 0.29
69 0.25
70 0.22
71 0.19
72 0.2
73 0.21
74 0.17
75 0.18
76 0.19
77 0.27
78 0.29
79 0.3
80 0.32
81 0.29
82 0.27
83 0.29
84 0.32
85 0.27
86 0.29
87 0.32
88 0.29
89 0.31
90 0.31
91 0.28
92 0.27
93 0.24
94 0.22
95 0.19
96 0.17
97 0.17
98 0.16
99 0.14
100 0.1
101 0.09
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.06
113 0.06
114 0.07
115 0.09
116 0.08
117 0.08
118 0.08
119 0.09
120 0.11
121 0.11
122 0.12
123 0.12
124 0.12
125 0.12
126 0.11
127 0.11
128 0.09
129 0.09
130 0.08
131 0.07
132 0.07
133 0.06
134 0.06
135 0.05
136 0.05
137 0.05
138 0.04
139 0.05
140 0.05
141 0.07
142 0.07
143 0.07
144 0.09
145 0.1
146 0.11
147 0.12
148 0.12
149 0.12
150 0.19
151 0.27
152 0.26
153 0.28
154 0.29
155 0.3
156 0.29
157 0.28
158 0.22
159 0.19
160 0.17
161 0.17
162 0.16
163 0.14
164 0.13
165 0.13
166 0.12
167 0.08
168 0.07
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.03
177 0.02
178 0.02
179 0.02
180 0.04
181 0.05
182 0.05
183 0.08
184 0.09
185 0.1
186 0.12
187 0.16
188 0.22
189 0.3
190 0.38
191 0.43
192 0.48
193 0.49
194 0.5
195 0.56
196 0.55
197 0.5
198 0.45
199 0.4
200 0.35
201 0.34
202 0.31
203 0.21
204 0.15
205 0.13
206 0.09
207 0.08
208 0.07
209 0.09
210 0.08
211 0.08
212 0.07
213 0.07
214 0.09
215 0.11
216 0.14
217 0.15
218 0.18
219 0.23
220 0.28
221 0.35
222 0.39
223 0.39
224 0.39
225 0.42
226 0.43
227 0.39
228 0.36
229 0.33
230 0.3
231 0.28
232 0.28
233 0.24
234 0.2
235 0.21
236 0.2
237 0.16
238 0.14
239 0.13
240 0.11
241 0.11
242 0.1
243 0.09
244 0.08
245 0.07
246 0.06
247 0.07
248 0.06
249 0.05
250 0.06
251 0.07
252 0.07