Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q59T44

Protein Details
Accession Q59T44    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-37HKRSATGAKRAQFRKKRKFELGRQPANTKHydrophilic
NLS Segment(s)
PositionSequence
8-49RHKRSATGAKRAQFRKKRKFELGRQPANTKIGPKRIHSVRTR
139-148AKRSRKVERK
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
IPR018283  Ribosomal_S8e_CS  
Gene Ontology GO:0009986  C:cell surface  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG cal:CAALFM_C205610CA  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
PROSITE View protein in PROSITE  
PS01193  RIBOSOMAL_S8E  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGPKRIHSVRTRGGNQKFRALRVETGNFSWGSEGVSRKTRIAGVVYHPSNNELVRTNTLTKSAVVQIDATPFRQWYENHYGATLGKKKGGAHAAHAAEVADAKRSRKVERKLAARSGAAAIESAVDSQFGSGRLYAVISSRPGQSGRCDGYILEGEELAFYLRRLTAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.66
4 0.72
5 0.77
6 0.78
7 0.78
8 0.8
9 0.8
10 0.83
11 0.86
12 0.88
13 0.9
14 0.89
15 0.91
16 0.9
17 0.89
18 0.84
19 0.78
20 0.72
21 0.66
22 0.57
23 0.53
24 0.49
25 0.49
26 0.47
27 0.47
28 0.51
29 0.53
30 0.6
31 0.58
32 0.59
33 0.58
34 0.62
35 0.65
36 0.66
37 0.68
38 0.68
39 0.65
40 0.66
41 0.61
42 0.54
43 0.53
44 0.47
45 0.42
46 0.39
47 0.41
48 0.33
49 0.32
50 0.32
51 0.26
52 0.23
53 0.2
54 0.13
55 0.11
56 0.12
57 0.13
58 0.13
59 0.19
60 0.2
61 0.2
62 0.21
63 0.2
64 0.19
65 0.19
66 0.18
67 0.17
68 0.24
69 0.25
70 0.24
71 0.24
72 0.23
73 0.23
74 0.21
75 0.17
76 0.11
77 0.12
78 0.14
79 0.16
80 0.17
81 0.16
82 0.18
83 0.17
84 0.15
85 0.15
86 0.15
87 0.13
88 0.11
89 0.11
90 0.1
91 0.13
92 0.13
93 0.12
94 0.1
95 0.1
96 0.11
97 0.13
98 0.13
99 0.16
100 0.24
101 0.26
102 0.25
103 0.25
104 0.25
105 0.23
106 0.29
107 0.28
108 0.2
109 0.19
110 0.21
111 0.21
112 0.25
113 0.3
114 0.25
115 0.23
116 0.29
117 0.28
118 0.26
119 0.26
120 0.22
121 0.16
122 0.16
123 0.13
124 0.11
125 0.12
126 0.13
127 0.18
128 0.2
129 0.27
130 0.35
131 0.42
132 0.47
133 0.54
134 0.62
135 0.63
136 0.67
137 0.64
138 0.55
139 0.49
140 0.4
141 0.32
142 0.24
143 0.17
144 0.11
145 0.08
146 0.08
147 0.07
148 0.05
149 0.05
150 0.05
151 0.05
152 0.07
153 0.07
154 0.08
155 0.08
156 0.08
157 0.08
158 0.09
159 0.09
160 0.09
161 0.11
162 0.12
163 0.14
164 0.15
165 0.17
166 0.18
167 0.2
168 0.23
169 0.29
170 0.3
171 0.29
172 0.28
173 0.26
174 0.29
175 0.31
176 0.28
177 0.21
178 0.17
179 0.16
180 0.15
181 0.15
182 0.12
183 0.09
184 0.07
185 0.09
186 0.11