Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U1GGI1

Protein Details
Accession U1GGI1   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MLDQQRSTKRKNQKLPHIAPTQNLKKSNRIPKPPPRPPPYPIHydrophilic
127-146EEPKRKTRVKETKVKSRDGKBasic
NLS Segment(s)
PositionSequence
25-37KKSNRIPKPPPRP
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MLDQQRSTKRKNQKLPHIAPTQNLKKSNRIPKPPPRPPPYPILTELDTRKRKRITENQDPKHSNKRECIIIRDEDLATPVPKHSNKRECIIIVDEDLAQPVPEPKIHFDPALGSTPGTAIDLCQSDEEPKRKTRVKETKVKSRDGKLQAWVEEVPDESLFCAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.84
5 0.76
6 0.71
7 0.7
8 0.68
9 0.64
10 0.64
11 0.58
12 0.58
13 0.65
14 0.71
15 0.7
16 0.71
17 0.74
18 0.78
19 0.86
20 0.87
21 0.88
22 0.84
23 0.8
24 0.74
25 0.72
26 0.65
27 0.59
28 0.52
29 0.46
30 0.4
31 0.4
32 0.41
33 0.43
34 0.48
35 0.46
36 0.5
37 0.5
38 0.51
39 0.56
40 0.61
41 0.61
42 0.64
43 0.72
44 0.72
45 0.77
46 0.77
47 0.72
48 0.72
49 0.68
50 0.61
51 0.55
52 0.51
53 0.49
54 0.48
55 0.47
56 0.41
57 0.36
58 0.34
59 0.3
60 0.27
61 0.19
62 0.19
63 0.15
64 0.12
65 0.1
66 0.09
67 0.12
68 0.15
69 0.2
70 0.27
71 0.35
72 0.37
73 0.39
74 0.41
75 0.37
76 0.36
77 0.33
78 0.25
79 0.18
80 0.16
81 0.13
82 0.11
83 0.11
84 0.08
85 0.06
86 0.05
87 0.06
88 0.06
89 0.08
90 0.09
91 0.12
92 0.17
93 0.19
94 0.19
95 0.18
96 0.19
97 0.2
98 0.22
99 0.19
100 0.14
101 0.13
102 0.13
103 0.13
104 0.11
105 0.08
106 0.05
107 0.07
108 0.08
109 0.09
110 0.1
111 0.1
112 0.15
113 0.22
114 0.27
115 0.29
116 0.33
117 0.41
118 0.47
119 0.52
120 0.58
121 0.63
122 0.67
123 0.73
124 0.76
125 0.8
126 0.78
127 0.82
128 0.78
129 0.73
130 0.74
131 0.7
132 0.66
133 0.63
134 0.63
135 0.55
136 0.51
137 0.44
138 0.36
139 0.3
140 0.27
141 0.21
142 0.16
143 0.15