Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59M50

Protein Details
Accession Q59M50   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-57ITEPTYKKPEKSTKRRKKKLEIACVYCRRSHydrophilic
NLS Segment(s)
PositionSequence
34-46KKPEKSTKRRKKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0034605  P:cellular response to heat  
GO:0071500  P:cellular response to nitrosative stress  
GO:0071466  P:cellular response to xenobiotic stimulus  
GO:0030447  P:filamentous growth  
GO:0036180  P:filamentous growth of a population of unicellular organisms in response to biotic stimulus  
GO:0036171  P:filamentous growth of a population of unicellular organisms in response to chemical stimulus  
GO:0036178  P:filamentous growth of a population of unicellular organisms in response to neutral pH  
GO:0031505  P:fungal-type cell wall organization  
GO:0061415  P:negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source  
GO:0061414  P:positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG cal:CAALFM_CR05530CA  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSTMSTQKANSSTPGETDSSSSLPPPEITEPTYKKPEKSTKRRKKKLEIACVYCRRSHMICDESRPCQRCIKRGIAHLCYDEPSNSRQRKKAAALRKTQSEGAPMVTSPITLPLTGSTGNQSPLPLPPLQASQSDIRSAPKTENSLQFSQPALHQQQMQENPQGASQSVHTNNTHIYSSQNQQQQPQHQQQLQQQQPQPQPQSRLIKNSVLSQTLPYNQQPFFYSEHANSEFSSLNDFLSMIDDPELVNGALNDDTDGLLNFGVGNNNNSGGSNSNINNTHNNNNNGFSISGGNSTTNLNAVLAYSPNSNLFPPTFGNEADSTQIQSQQQQPELTQQPPALNPVKVEPQAEKTEQQPVISDSARDKFFLTAADPTTEISPEERLKQVIKAKLEAGLLQPYNYAKGYARLQRYMDNYMNISSRQRILKPLSIFRPAFRAIARTLKDVDLVLVEESFERMLLDYDRVFTAMAIPACLWRRTGEIYRGNKEFASLVGVTTDDLKDGKLAIYELMSEESAVNFWEKYGAIAFDKGQKAVLTSCNLRTRDGIKRKSCCFSFTIRRDRYNIPSCIVGNFIPIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.27
5 0.25
6 0.23
7 0.22
8 0.21
9 0.19
10 0.19
11 0.19
12 0.21
13 0.22
14 0.23
15 0.26
16 0.35
17 0.39
18 0.44
19 0.54
20 0.53
21 0.53
22 0.6
23 0.67
24 0.68
25 0.74
26 0.79
27 0.8
28 0.88
29 0.94
30 0.95
31 0.95
32 0.94
33 0.93
34 0.93
35 0.92
36 0.88
37 0.89
38 0.87
39 0.79
40 0.71
41 0.63
42 0.57
43 0.49
44 0.46
45 0.44
46 0.43
47 0.43
48 0.49
49 0.52
50 0.53
51 0.61
52 0.59
53 0.54
54 0.56
55 0.58
56 0.57
57 0.59
58 0.62
59 0.59
60 0.65
61 0.71
62 0.67
63 0.65
64 0.6
65 0.54
66 0.45
67 0.41
68 0.34
69 0.27
70 0.28
71 0.34
72 0.39
73 0.45
74 0.49
75 0.52
76 0.58
77 0.65
78 0.69
79 0.69
80 0.7
81 0.73
82 0.73
83 0.74
84 0.7
85 0.64
86 0.56
87 0.49
88 0.41
89 0.34
90 0.28
91 0.21
92 0.2
93 0.16
94 0.15
95 0.11
96 0.14
97 0.12
98 0.11
99 0.12
100 0.1
101 0.13
102 0.13
103 0.14
104 0.13
105 0.14
106 0.15
107 0.15
108 0.15
109 0.14
110 0.16
111 0.19
112 0.16
113 0.16
114 0.16
115 0.19
116 0.2
117 0.2
118 0.21
119 0.21
120 0.22
121 0.23
122 0.22
123 0.23
124 0.23
125 0.24
126 0.25
127 0.25
128 0.28
129 0.32
130 0.38
131 0.41
132 0.41
133 0.41
134 0.39
135 0.36
136 0.32
137 0.27
138 0.27
139 0.24
140 0.23
141 0.24
142 0.24
143 0.31
144 0.34
145 0.36
146 0.32
147 0.32
148 0.3
149 0.28
150 0.27
151 0.2
152 0.16
153 0.14
154 0.18
155 0.18
156 0.22
157 0.21
158 0.22
159 0.22
160 0.24
161 0.23
162 0.16
163 0.17
164 0.17
165 0.21
166 0.26
167 0.31
168 0.3
169 0.36
170 0.42
171 0.47
172 0.52
173 0.56
174 0.56
175 0.52
176 0.57
177 0.57
178 0.62
179 0.59
180 0.58
181 0.54
182 0.55
183 0.58
184 0.6
185 0.59
186 0.53
187 0.52
188 0.52
189 0.57
190 0.52
191 0.53
192 0.49
193 0.48
194 0.44
195 0.46
196 0.4
197 0.33
198 0.31
199 0.26
200 0.25
201 0.23
202 0.25
203 0.2
204 0.22
205 0.2
206 0.21
207 0.21
208 0.21
209 0.22
210 0.21
211 0.22
212 0.18
213 0.23
214 0.24
215 0.23
216 0.2
217 0.19
218 0.17
219 0.15
220 0.17
221 0.13
222 0.11
223 0.1
224 0.1
225 0.08
226 0.09
227 0.08
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.07
234 0.05
235 0.05
236 0.04
237 0.05
238 0.05
239 0.05
240 0.05
241 0.04
242 0.05
243 0.05
244 0.05
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.05
251 0.05
252 0.06
253 0.06
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.08
260 0.1
261 0.11
262 0.13
263 0.15
264 0.16
265 0.19
266 0.21
267 0.25
268 0.28
269 0.3
270 0.28
271 0.29
272 0.28
273 0.24
274 0.21
275 0.17
276 0.12
277 0.1
278 0.09
279 0.08
280 0.08
281 0.08
282 0.08
283 0.08
284 0.07
285 0.06
286 0.05
287 0.05
288 0.05
289 0.05
290 0.05
291 0.06
292 0.06
293 0.06
294 0.07
295 0.08
296 0.08
297 0.08
298 0.08
299 0.09
300 0.09
301 0.11
302 0.12
303 0.11
304 0.13
305 0.13
306 0.13
307 0.13
308 0.13
309 0.11
310 0.1
311 0.14
312 0.12
313 0.14
314 0.19
315 0.2
316 0.23
317 0.22
318 0.22
319 0.26
320 0.29
321 0.27
322 0.24
323 0.22
324 0.21
325 0.21
326 0.25
327 0.21
328 0.18
329 0.18
330 0.18
331 0.21
332 0.21
333 0.22
334 0.19
335 0.21
336 0.24
337 0.26
338 0.25
339 0.22
340 0.28
341 0.28
342 0.26
343 0.23
344 0.2
345 0.22
346 0.21
347 0.2
348 0.15
349 0.19
350 0.19
351 0.19
352 0.18
353 0.15
354 0.15
355 0.15
356 0.14
357 0.12
358 0.13
359 0.13
360 0.13
361 0.13
362 0.13
363 0.12
364 0.11
365 0.09
366 0.12
367 0.13
368 0.15
369 0.16
370 0.17
371 0.18
372 0.23
373 0.29
374 0.3
375 0.31
376 0.3
377 0.3
378 0.31
379 0.3
380 0.26
381 0.21
382 0.21
383 0.19
384 0.17
385 0.18
386 0.15
387 0.16
388 0.15
389 0.15
390 0.1
391 0.14
392 0.2
393 0.26
394 0.3
395 0.32
396 0.33
397 0.37
398 0.4
399 0.42
400 0.39
401 0.33
402 0.3
403 0.29
404 0.29
405 0.25
406 0.24
407 0.2
408 0.22
409 0.24
410 0.24
411 0.29
412 0.32
413 0.38
414 0.4
415 0.45
416 0.45
417 0.49
418 0.49
419 0.43
420 0.43
421 0.38
422 0.35
423 0.29
424 0.27
425 0.22
426 0.3
427 0.31
428 0.28
429 0.29
430 0.27
431 0.27
432 0.24
433 0.22
434 0.14
435 0.13
436 0.1
437 0.08
438 0.08
439 0.07
440 0.07
441 0.07
442 0.06
443 0.05
444 0.05
445 0.07
446 0.08
447 0.1
448 0.1
449 0.12
450 0.12
451 0.12
452 0.12
453 0.1
454 0.12
455 0.13
456 0.13
457 0.12
458 0.12
459 0.17
460 0.2
461 0.2
462 0.19
463 0.16
464 0.19
465 0.24
466 0.3
467 0.34
468 0.4
469 0.47
470 0.52
471 0.53
472 0.52
473 0.46
474 0.41
475 0.33
476 0.24
477 0.21
478 0.15
479 0.13
480 0.12
481 0.12
482 0.11
483 0.13
484 0.13
485 0.09
486 0.09
487 0.09
488 0.09
489 0.1
490 0.1
491 0.09
492 0.1
493 0.09
494 0.09
495 0.1
496 0.1
497 0.11
498 0.1
499 0.1
500 0.1
501 0.09
502 0.09
503 0.09
504 0.09
505 0.08
506 0.08
507 0.09
508 0.09
509 0.1
510 0.12
511 0.13
512 0.14
513 0.16
514 0.18
515 0.24
516 0.26
517 0.25
518 0.25
519 0.22
520 0.23
521 0.24
522 0.28
523 0.25
524 0.28
525 0.35
526 0.41
527 0.42
528 0.42
529 0.43
530 0.44
531 0.5
532 0.56
533 0.58
534 0.6
535 0.67
536 0.71
537 0.76
538 0.72
539 0.65
540 0.58
541 0.58
542 0.6
543 0.61
544 0.66
545 0.64
546 0.68
547 0.69
548 0.72
549 0.72
550 0.7
551 0.64
552 0.55
553 0.53
554 0.49
555 0.44
556 0.41
557 0.3
558 0.24