FuNGI

Q59M50

Protein Details

Accession

Q59M50

Localization Confidence

Medium

Confidence Score

14.5

NoLS Segment(s)

Position	Sequence	Protein Nature
28-57	ITEPTYKKPEKSTKRRKKKLEIACVYCRRS	Hydrophilic

NLS Segment(s)

Position	Sequence
34-46	KKPEKSTKRRKKK

Subcellular Location(s)

nucl 26.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0003700 F:DNA-binding transcription factor activity GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000977 F:RNA polymerase II transcription regulatory region sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0034605 P:cellular response to heat GO:0071500 P:cellular response to nitrosative stress GO:0071466 P:cellular response to xenobiotic stimulus GO:0030447 P:filamentous growth GO:0036180 P:filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:0036171 P:filamentous growth of a population of unicellular organisms in response to chemical stimulus GO:0036178 P:filamentous growth of a population of unicellular organisms in response to neutral pH GO:0031505 P:fungal-type cell wall organization GO:0061415 P:negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source GO:0061414 P:positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source GO:0006355 P:regulation of DNA-templated transcription
KEGG	cal:CAALFM_CR05530CA -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MSTMSTQKANSSTPGETDSSSSLPPPEITEPTYKKPEKSTKRRKKKLEIACVYCRRSHMICDESRPCQRCIKRGIAHLCYDEPSNSRQRKKAAALRKTQSEGAPMVTSPITLPLTGSTGNQSPLPLPPLQASQSDIRSAPKTENSLQFSQPALHQQQMQENPQGASQSVHTNNTHIYSSQNQQQQPQHQQQLQQQQPQPQPQSRLIKNSVLSQTLPYNQQPFFYSEHANSEFSSLNDFLSMIDDPELVNGALNDDTDGLLNFGVGNNNNSGGSNSNINNTHNNNNNGFSISGGNSTTNLNAVLAYSPNSNLFPPTFGNEADSTQIQSQQQQPELTQQPPALNPVKVEPQAEKTEQQPVISDSARDKFFLTAADPTTEISPEERLKQVIKAKLEAGLLQPYNYAKGYARLQRYMDNYMNISSRQRILKPLSIFRPAFRAIARTLKDVDLVLVEESFERMLLDYDRVFTAMAIPACLWRRTGEIYRGNKEFASLVGVTTDDLKDGKLAIYELMSEESAVNFWEKYGAIAFDKGQKAVLTSCNLRTRDGIKRKSCCFSFTIRRDRYNIPSCIVGNFIPIDP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.31
2	0.29
3	0.27
4	0.27
5	0.25
6	0.23
7	0.22
8	0.21
9	0.19
10	0.19
11	0.19
12	0.21
13	0.22
14	0.23
15	0.26
16	0.35
17	0.39
18	0.44
19	0.54
20	0.53
21	0.53
22	0.6
23	0.67
24	0.68
25	0.74
26	0.79
27	0.8
28	0.88
29	0.94
30	0.95
31	0.95
32	0.94
33	0.93
34	0.93
35	0.92
36	0.88
37	0.89
38	0.87
39	0.79
40	0.71
41	0.63
42	0.57
43	0.49
44	0.46
45	0.44
46	0.43
47	0.43
48	0.49
49	0.52
50	0.53
51	0.61
52	0.59
53	0.54
54	0.56
55	0.58
56	0.57
57	0.59
58	0.62
59	0.59
60	0.65
61	0.71
62	0.67
63	0.65
64	0.6
65	0.54
66	0.45
67	0.41
68	0.34
69	0.27
70	0.28
71	0.34
72	0.39
73	0.45
74	0.49
75	0.52
76	0.58
77	0.65
78	0.69
79	0.69
80	0.7
81	0.73
82	0.73
83	0.74
84	0.7
85	0.64
86	0.56
87	0.49
88	0.41
89	0.34
90	0.28
91	0.21
92	0.2
93	0.16
94	0.15
95	0.11
96	0.14
97	0.12
98	0.11
99	0.12
100	0.1
101	0.13
102	0.13
103	0.14
104	0.13
105	0.14
106	0.15
107	0.15
108	0.15
109	0.14
110	0.16
111	0.19
112	0.16
113	0.16
114	0.16
115	0.19
116	0.2
117	0.2
118	0.21
119	0.21
120	0.22
121	0.23
122	0.22
123	0.23
124	0.23
125	0.24
126	0.25
127	0.25
128	0.28
129	0.32
130	0.38
131	0.41
132	0.41
133	0.41
134	0.39
135	0.36
136	0.32
137	0.27
138	0.27
139	0.24
140	0.23
141	0.24
142	0.24
143	0.31
144	0.34
145	0.36
146	0.32
147	0.32
148	0.3
149	0.28
150	0.27
151	0.2
152	0.16
153	0.14
154	0.18
155	0.18
156	0.22
157	0.21
158	0.22
159	0.22
160	0.24
161	0.23
162	0.16
163	0.17
164	0.17
165	0.21
166	0.26
167	0.31
168	0.3
169	0.36
170	0.42
171	0.47
172	0.52
173	0.56
174	0.56
175	0.52
176	0.57
177	0.57
178	0.62
179	0.59
180	0.58
181	0.54
182	0.55
183	0.58
184	0.6
185	0.59
186	0.53
187	0.52
188	0.52
189	0.57
190	0.52
191	0.53
192	0.49
193	0.48
194	0.44
195	0.46
196	0.4
197	0.33
198	0.31
199	0.26
200	0.25
201	0.23
202	0.25
203	0.2
204	0.22
205	0.2
206	0.21
207	0.21
208	0.21
209	0.22
210	0.21
211	0.22
212	0.18
213	0.23
214	0.24
215	0.23
216	0.2
217	0.19
218	0.17
219	0.15
220	0.17
221	0.13
222	0.11
223	0.1
224	0.1
225	0.08
226	0.09
227	0.08
228	0.06
229	0.06
230	0.06
231	0.06
232	0.06
233	0.07
234	0.05
235	0.05
236	0.04
237	0.05
238	0.05
239	0.05
240	0.05
241	0.04
242	0.05
243	0.05
244	0.05
245	0.04
246	0.04
247	0.04
248	0.04
249	0.04
250	0.05
251	0.05
252	0.06
253	0.06
254	0.07
255	0.07
256	0.08
257	0.08
258	0.08
259	0.08
260	0.1
261	0.11
262	0.13
263	0.15
264	0.16
265	0.19
266	0.21
267	0.25
268	0.28
269	0.3
270	0.28
271	0.29
272	0.28
273	0.24
274	0.21
275	0.17
276	0.12
277	0.1
278	0.09
279	0.08
280	0.08
281	0.08
282	0.08
283	0.08
284	0.07
285	0.06
286	0.05
287	0.05
288	0.05
289	0.05
290	0.05
291	0.06
292	0.06
293	0.06
294	0.07
295	0.08
296	0.08
297	0.08
298	0.08
299	0.09
300	0.09
301	0.11
302	0.12
303	0.11
304	0.13
305	0.13
306	0.13
307	0.13
308	0.13
309	0.11
310	0.1
311	0.14
312	0.12
313	0.14
314	0.19
315	0.2
316	0.23
317	0.22
318	0.22
319	0.26
320	0.29
321	0.27
322	0.24
323	0.22
324	0.21
325	0.21
326	0.25
327	0.21
328	0.18
329	0.18
330	0.18
331	0.21
332	0.21
333	0.22
334	0.19
335	0.21
336	0.24
337	0.26
338	0.25
339	0.22
340	0.28
341	0.28
342	0.26
343	0.23
344	0.2
345	0.22
346	0.21
347	0.2
348	0.15
349	0.19
350	0.19
351	0.19
352	0.18
353	0.15
354	0.15
355	0.15
356	0.14
357	0.12
358	0.13
359	0.13
360	0.13
361	0.13
362	0.13
363	0.12
364	0.11
365	0.09
366	0.12
367	0.13
368	0.15
369	0.16
370	0.17
371	0.18
372	0.23
373	0.29
374	0.3
375	0.31
376	0.3
377	0.3
378	0.31
379	0.3
380	0.26
381	0.21
382	0.21
383	0.19
384	0.17
385	0.18
386	0.15
387	0.16
388	0.15
389	0.15
390	0.1
391	0.14
392	0.2
393	0.26
394	0.3
395	0.32
396	0.33
397	0.37
398	0.4
399	0.42
400	0.39
401	0.33
402	0.3
403	0.29
404	0.29
405	0.25
406	0.24
407	0.2
408	0.22
409	0.24
410	0.24
411	0.29
412	0.32
413	0.38
414	0.4
415	0.45
416	0.45
417	0.49
418	0.49
419	0.43
420	0.43
421	0.38
422	0.35
423	0.29
424	0.27
425	0.22
426	0.3
427	0.31
428	0.28
429	0.29
430	0.27
431	0.27
432	0.24
433	0.22
434	0.14
435	0.13
436	0.1
437	0.08
438	0.08
439	0.07
440	0.07
441	0.07
442	0.06
443	0.05
444	0.05
445	0.07
446	0.08
447	0.1
448	0.1
449	0.12
450	0.12
451	0.12
452	0.12
453	0.1
454	0.12
455	0.13
456	0.13
457	0.12
458	0.12
459	0.17
460	0.2
461	0.2
462	0.19
463	0.16
464	0.19
465	0.24
466	0.3
467	0.34
468	0.4
469	0.47
470	0.52
471	0.53
472	0.52
473	0.46
474	0.41
475	0.33
476	0.24
477	0.21
478	0.15
479	0.13
480	0.12
481	0.12
482	0.11
483	0.13
484	0.13
485	0.09
486	0.09
487	0.09
488	0.09
489	0.1
490	0.1
491	0.09
492	0.1
493	0.09
494	0.09
495	0.1
496	0.1
497	0.11
498	0.1
499	0.1
500	0.1
501	0.09
502	0.09
503	0.09
504	0.09
505	0.08
506	0.08
507	0.09
508	0.09
509	0.1
510	0.12
511	0.13
512	0.14
513	0.16
514	0.18
515	0.24
516	0.26
517	0.25
518	0.25
519	0.22
520	0.23
521	0.24
522	0.28
523	0.25
524	0.28
525	0.35
526	0.41
527	0.42
528	0.42
529	0.43
530	0.44
531	0.5
532	0.56
533	0.58
534	0.6
535	0.67
536	0.71
537	0.76
538	0.72
539	0.65
540	0.58
541	0.58
542	0.6
543	0.61
544	0.66
545	0.64
546	0.68
547	0.69
548	0.72
549	0.72
550	0.7
551	0.64
552	0.55
553	0.53
554	0.49
555	0.44
556	0.41
557	0.3
558	0.24

Q59M50

3D AlphaFold-predicted Structure Viewer