Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PVE1

Protein Details
Accession U7PVE1   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
127-146DTNGKKPRSPTQRPEQPEKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MTGHLASYGRGGAGNMADSTKSPKLQPKDLETPVLRTSVVTTGRGGTGNMAKNTDPKETRARQDVEHIVRRHSNGATHAGRGGAGNVFKAGSADAEAAAGASAGSAVLDDAHPASSASSATLRSSNDTNGKKPRSPTQRPEQPEKSLATKGKEWLLGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.1
5 0.1
6 0.17
7 0.19
8 0.2
9 0.23
10 0.31
11 0.36
12 0.44
13 0.5
14 0.52
15 0.57
16 0.57
17 0.61
18 0.53
19 0.52
20 0.45
21 0.4
22 0.31
23 0.23
24 0.22
25 0.2
26 0.21
27 0.17
28 0.17
29 0.17
30 0.17
31 0.18
32 0.16
33 0.13
34 0.16
35 0.2
36 0.2
37 0.2
38 0.2
39 0.23
40 0.26
41 0.3
42 0.26
43 0.25
44 0.34
45 0.36
46 0.4
47 0.43
48 0.42
49 0.37
50 0.42
51 0.45
52 0.42
53 0.45
54 0.42
55 0.38
56 0.38
57 0.38
58 0.34
59 0.27
60 0.23
61 0.17
62 0.23
63 0.21
64 0.2
65 0.19
66 0.16
67 0.16
68 0.14
69 0.13
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.05
78 0.04
79 0.04
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.09
108 0.12
109 0.12
110 0.15
111 0.17
112 0.21
113 0.28
114 0.31
115 0.37
116 0.44
117 0.49
118 0.51
119 0.54
120 0.59
121 0.61
122 0.67
123 0.69
124 0.71
125 0.75
126 0.77
127 0.82
128 0.79
129 0.74
130 0.7
131 0.64
132 0.58
133 0.56
134 0.55
135 0.5
136 0.47
137 0.45
138 0.44
139 0.47