Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7Q5S4

Protein Details
Accession U7Q5S4   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
186-209AEGLPTKKKEKKEKQARPPKAAPPBasic
NLS Segment(s)
PositionSequence
128-142KERLKKEKAAAAAAA
153-162DRTKKQDKKP
190-211PTKKKEKKEKQARPPKAAPPPP
Subcellular Location(s) cyto 22, mito 2.5, mito_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
CDD cd10304  GST_C_Arc1p_N_like  
Amino Acid Sequences MVAIASQTYTPAEETEIQKWVDTAASAASTPSVLAELNTLLATRTTVLGSKPSKADVAVYESLAPVVKAWTAEQRTGKEGLPNIVRLVDFVQNSPALFGVTVADADKVAIDAEEVLYVAPAVDSKAEKERLKKEKAAAAAAAAPAGEEKQLADRTKKQDKKPAAEGEAAAGGAAGAAAGAAAGATAEGLPTKKKEKKEKQARPPKAAPPPPAPPSPSLIDLRVGHILKAVKHPEADSLYVSTIAMGDAKGTTDTEEYEGQVVRTVCSGLNGLVPLEEMQGRRVVVVCNLKPVKMRGIKSAAMVLAASPRLKEGEEDHHGGPVELVNPPADAPAGTKVFFEGWKGEPEGQLNPKKKVWEMFQPGFTTTDDLEVGFDAGVVKELGKEGVGKLVTESGGVCTVKSLKGATVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.28
4 0.27
5 0.27
6 0.26
7 0.23
8 0.19
9 0.15
10 0.12
11 0.09
12 0.1
13 0.1
14 0.1
15 0.09
16 0.08
17 0.08
18 0.07
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.11
34 0.12
35 0.2
36 0.22
37 0.26
38 0.27
39 0.27
40 0.28
41 0.26
42 0.27
43 0.21
44 0.26
45 0.23
46 0.22
47 0.21
48 0.2
49 0.2
50 0.18
51 0.15
52 0.08
53 0.08
54 0.08
55 0.08
56 0.1
57 0.18
58 0.21
59 0.27
60 0.31
61 0.32
62 0.35
63 0.37
64 0.36
65 0.32
66 0.32
67 0.32
68 0.3
69 0.29
70 0.27
71 0.26
72 0.24
73 0.21
74 0.21
75 0.19
76 0.17
77 0.16
78 0.18
79 0.17
80 0.17
81 0.17
82 0.14
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.05
110 0.06
111 0.08
112 0.15
113 0.21
114 0.24
115 0.31
116 0.41
117 0.48
118 0.54
119 0.56
120 0.55
121 0.53
122 0.53
123 0.48
124 0.38
125 0.3
126 0.26
127 0.21
128 0.16
129 0.11
130 0.08
131 0.06
132 0.06
133 0.05
134 0.04
135 0.04
136 0.08
137 0.13
138 0.15
139 0.2
140 0.26
141 0.34
142 0.45
143 0.52
144 0.54
145 0.59
146 0.64
147 0.66
148 0.68
149 0.66
150 0.59
151 0.52
152 0.47
153 0.38
154 0.31
155 0.24
156 0.15
157 0.09
158 0.06
159 0.04
160 0.03
161 0.02
162 0.01
163 0.01
164 0.01
165 0.01
166 0.01
167 0.01
168 0.01
169 0.01
170 0.01
171 0.01
172 0.02
173 0.02
174 0.03
175 0.03
176 0.05
177 0.07
178 0.15
179 0.21
180 0.29
181 0.4
182 0.5
183 0.61
184 0.71
185 0.79
186 0.83
187 0.88
188 0.88
189 0.85
190 0.8
191 0.77
192 0.75
193 0.7
194 0.64
195 0.58
196 0.56
197 0.52
198 0.48
199 0.43
200 0.35
201 0.32
202 0.29
203 0.27
204 0.22
205 0.19
206 0.2
207 0.19
208 0.19
209 0.21
210 0.19
211 0.16
212 0.18
213 0.19
214 0.17
215 0.22
216 0.23
217 0.19
218 0.19
219 0.2
220 0.2
221 0.21
222 0.2
223 0.15
224 0.14
225 0.13
226 0.12
227 0.12
228 0.08
229 0.07
230 0.06
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.06
239 0.06
240 0.07
241 0.09
242 0.09
243 0.09
244 0.1
245 0.11
246 0.1
247 0.13
248 0.13
249 0.11
250 0.1
251 0.11
252 0.09
253 0.1
254 0.11
255 0.07
256 0.08
257 0.08
258 0.08
259 0.07
260 0.07
261 0.07
262 0.07
263 0.09
264 0.08
265 0.09
266 0.11
267 0.11
268 0.11
269 0.12
270 0.12
271 0.15
272 0.23
273 0.22
274 0.3
275 0.31
276 0.32
277 0.33
278 0.35
279 0.38
280 0.37
281 0.39
282 0.36
283 0.41
284 0.41
285 0.39
286 0.4
287 0.3
288 0.24
289 0.21
290 0.15
291 0.12
292 0.13
293 0.12
294 0.09
295 0.1
296 0.11
297 0.11
298 0.12
299 0.14
300 0.2
301 0.25
302 0.29
303 0.28
304 0.3
305 0.29
306 0.28
307 0.24
308 0.18
309 0.14
310 0.11
311 0.11
312 0.09
313 0.09
314 0.09
315 0.09
316 0.08
317 0.07
318 0.08
319 0.13
320 0.14
321 0.14
322 0.14
323 0.15
324 0.17
325 0.17
326 0.17
327 0.15
328 0.16
329 0.19
330 0.22
331 0.23
332 0.23
333 0.25
334 0.3
335 0.35
336 0.42
337 0.44
338 0.46
339 0.47
340 0.49
341 0.5
342 0.5
343 0.47
344 0.49
345 0.53
346 0.54
347 0.55
348 0.54
349 0.51
350 0.46
351 0.41
352 0.33
353 0.24
354 0.21
355 0.16
356 0.14
357 0.13
358 0.12
359 0.12
360 0.08
361 0.08
362 0.07
363 0.06
364 0.07
365 0.07
366 0.07
367 0.07
368 0.08
369 0.09
370 0.09
371 0.1
372 0.1
373 0.16
374 0.16
375 0.15
376 0.16
377 0.18
378 0.17
379 0.17
380 0.16
381 0.12
382 0.17
383 0.17
384 0.15
385 0.16
386 0.19
387 0.2
388 0.21
389 0.2