Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7Q189

Protein Details
Accession U7Q189    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44QESKKTPKGRAHKREQYTRRFBasic
NLS Segment(s)
PositionSequence
25-37ESKKTPKGRAHKR
Subcellular Location(s) mito 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQESKKTPKGRAHKREQYTRRFVNVTTTPGGKRKVSFRKAAQEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.47
5 0.49
6 0.58
7 0.58
8 0.63
9 0.6
10 0.6
11 0.63
12 0.62
13 0.64
14 0.61
15 0.62
16 0.6
17 0.65
18 0.68
19 0.68
20 0.73
21 0.76
22 0.78
23 0.79
24 0.81
25 0.81
26 0.79
27 0.77
28 0.71
29 0.65
30 0.57
31 0.5
32 0.48
33 0.43
34 0.38
35 0.32
36 0.32
37 0.31
38 0.34
39 0.38
40 0.33
41 0.33
42 0.39
43 0.47
44 0.51
45 0.58
46 0.6