Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7Q370

Protein Details
Accession U7Q370    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTTNRYKYFRWTKRTARITFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 5, E.R. 5, golg 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTNRYKYFRWTKRTARITFTYVVFVPALFGILAYSTEGKWNLRGKRRGDVLAEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.77
3 0.72
4 0.67
5 0.62
6 0.56
7 0.47
8 0.38
9 0.29
10 0.26
11 0.2
12 0.15
13 0.11
14 0.08
15 0.08
16 0.05
17 0.05
18 0.03
19 0.03
20 0.04
21 0.04
22 0.05
23 0.05
24 0.08
25 0.09
26 0.1
27 0.16
28 0.23
29 0.31
30 0.4
31 0.48
32 0.5
33 0.57
34 0.62
35 0.61