Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7Q5F7

Protein Details
Accession U7Q5F7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVNIPSKGKECRKHTQHKVTQYKTGKHydrophilic
67-87ECTSCKSKKQLPLKRTKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPSKGKECRKHTQHKVTQYKTGKASLFAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKIVLRLECTSCKSKKQLPLKRTKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.86
5 0.89
6 0.82
7 0.82
8 0.77
9 0.72
10 0.64
11 0.61
12 0.51
13 0.43
14 0.41
15 0.39
16 0.4
17 0.37
18 0.43
19 0.44
20 0.48
21 0.53
22 0.57
23 0.55
24 0.58
25 0.64
26 0.62
27 0.63
28 0.61
29 0.6
30 0.59
31 0.6
32 0.51
33 0.45
34 0.42
35 0.34
36 0.37
37 0.38
38 0.36
39 0.32
40 0.39
41 0.43
42 0.49
43 0.59
44 0.61
45 0.6
46 0.64
47 0.7
48 0.7
49 0.69
50 0.67
51 0.62
52 0.59
53 0.58
54 0.53
55 0.48
56 0.47
57 0.43
58 0.41
59 0.42
60 0.45
61 0.49
62 0.57
63 0.62
64 0.66
65 0.74
66 0.79
67 0.82
68 0.83
69 0.78
70 0.75
71 0.68
72 0.64
73 0.63
74 0.62
75 0.61
76 0.58
77 0.54
78 0.47
79 0.46
80 0.41