Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7PPB9

Protein Details
Accession U7PPB9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 13, mito 8.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVILDKPTSEKLYKDVQSYRLVTVAVLVDRLKINGSLARKCLADLEEKGQIKQVVGHSKMKIFTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.42
15 0.38
16 0.31
17 0.24
18 0.23
19 0.21
20 0.23
21 0.19
22 0.16
23 0.16
24 0.23
25 0.25
26 0.28
27 0.29
28 0.29
29 0.33
30 0.34
31 0.31
32 0.24
33 0.22
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.1
47 0.14
48 0.15
49 0.17
50 0.19
51 0.18
52 0.18
53 0.19
54 0.17
55 0.19
56 0.18
57 0.21
58 0.26
59 0.27
60 0.27
61 0.29
62 0.28
63 0.23
64 0.26
65 0.28
66 0.3
67 0.33
68 0.39
69 0.37
70 0.4
71 0.45
72 0.43
73 0.42
74 0.35
75 0.34
76 0.35