Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PUA4

Protein Details
Accession U7PUA4   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-83MYRYRYTIRIRSRKKRRHRRRRHAGSKSSKSSKSBasic
NLS Segment(s)
PositionSequence
58-80RIRSRKKRRHRRRRHAGSKSSKS
Subcellular Location(s) mito 15, cyto_nucl 4, nucl 3.5, cyto 3.5, plas 1, extr 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHPSFDGNSKINAASNVLSKRQSAQTTNVTIGVVVAVLLTLFVVCVVAFMYRYRYTIRIRSRKKRRHRRRRHAGSKSSKSSKSVSDSAPPSPADGAPGPSQPPPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.25
5 0.25
6 0.24
7 0.27
8 0.31
9 0.34
10 0.31
11 0.33
12 0.36
13 0.37
14 0.38
15 0.34
16 0.28
17 0.23
18 0.2
19 0.14
20 0.08
21 0.05
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.04
36 0.04
37 0.09
38 0.09
39 0.11
40 0.12
41 0.16
42 0.19
43 0.27
44 0.36
45 0.43
46 0.52
47 0.62
48 0.71
49 0.78
50 0.86
51 0.89
52 0.91
53 0.92
54 0.95
55 0.95
56 0.95
57 0.97
58 0.97
59 0.95
60 0.95
61 0.94
62 0.92
63 0.89
64 0.85
65 0.76
66 0.68
67 0.6
68 0.55
69 0.5
70 0.46
71 0.4
72 0.4
73 0.4
74 0.39
75 0.4
76 0.35
77 0.3
78 0.27
79 0.24
80 0.2
81 0.19
82 0.21
83 0.2
84 0.22
85 0.23
86 0.24