Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PS43

Protein Details
Accession U7PS43   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
293-317GGGAREPKALQKRRRRTWLAVQGGVHydrophilic
NLS Segment(s)
PositionSequence
300-307KALQKRRR
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039960  MCP1  
IPR012472  MCP1_TM  
Gene Ontology GO:0016020  C:membrane  
GO:0055088  P:lipid homeostasis  
Pfam View protein in Pfam  
PF07950  MCP1_TM  
Amino Acid Sequences MSNTRPQLAGKASQDTLASMLELEPMPMPDSPLPTPPAAADVETDKELPPLPSEGSDDAEADAGAGVLSSAKHGHSRSVSATIKGTTTALGLSHGHGAVYYLSRIQRYSSYAFTIFSSVHLATTSLIPLATRSVPASESYLLLAREIYQTRLSEPLLVFLPIAAHVAAGVGLRLVRRSQNARRYGRTTASNWPPFSVIAASGYGFAVAVGAHIFLNRLLPVAVQGDSSDIGLAYVAHGFARQPVVSWLSYGAFLAAASGHMVWGWARWLGVAQRAAWSSLDLLRGGDRDVSAGGGAREPKALQKRRRRTWLAVQGGVLLAFCLWASGGLGVVARGGPVQGWVAKVYDELYAKTLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.27
4 0.19
5 0.16
6 0.1
7 0.1
8 0.11
9 0.1
10 0.1
11 0.1
12 0.1
13 0.12
14 0.12
15 0.15
16 0.15
17 0.2
18 0.2
19 0.24
20 0.26
21 0.25
22 0.25
23 0.22
24 0.22
25 0.19
26 0.17
27 0.15
28 0.14
29 0.17
30 0.17
31 0.18
32 0.15
33 0.16
34 0.17
35 0.16
36 0.15
37 0.15
38 0.15
39 0.16
40 0.19
41 0.19
42 0.2
43 0.19
44 0.18
45 0.16
46 0.15
47 0.13
48 0.1
49 0.08
50 0.05
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.07
59 0.12
60 0.13
61 0.18
62 0.19
63 0.22
64 0.24
65 0.31
66 0.32
67 0.3
68 0.31
69 0.27
70 0.26
71 0.23
72 0.21
73 0.13
74 0.11
75 0.1
76 0.08
77 0.09
78 0.09
79 0.09
80 0.11
81 0.1
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.08
88 0.1
89 0.11
90 0.13
91 0.13
92 0.14
93 0.16
94 0.19
95 0.21
96 0.2
97 0.22
98 0.22
99 0.22
100 0.21
101 0.2
102 0.16
103 0.13
104 0.14
105 0.11
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.09
112 0.06
113 0.06
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.08
120 0.08
121 0.09
122 0.1
123 0.12
124 0.11
125 0.1
126 0.1
127 0.12
128 0.11
129 0.11
130 0.1
131 0.08
132 0.11
133 0.12
134 0.13
135 0.13
136 0.13
137 0.14
138 0.17
139 0.16
140 0.15
141 0.15
142 0.15
143 0.13
144 0.13
145 0.11
146 0.09
147 0.09
148 0.06
149 0.07
150 0.05
151 0.04
152 0.03
153 0.03
154 0.04
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.04
161 0.06
162 0.07
163 0.1
164 0.17
165 0.25
166 0.33
167 0.42
168 0.46
169 0.5
170 0.52
171 0.52
172 0.49
173 0.45
174 0.4
175 0.39
176 0.43
177 0.44
178 0.4
179 0.38
180 0.35
181 0.31
182 0.28
183 0.2
184 0.12
185 0.07
186 0.08
187 0.07
188 0.07
189 0.07
190 0.06
191 0.05
192 0.05
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.08
215 0.06
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.06
227 0.08
228 0.08
229 0.08
230 0.1
231 0.13
232 0.13
233 0.13
234 0.13
235 0.11
236 0.12
237 0.11
238 0.09
239 0.06
240 0.06
241 0.05
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.05
251 0.06
252 0.06
253 0.06
254 0.06
255 0.08
256 0.09
257 0.14
258 0.15
259 0.15
260 0.17
261 0.18
262 0.19
263 0.18
264 0.17
265 0.14
266 0.14
267 0.15
268 0.12
269 0.12
270 0.13
271 0.13
272 0.13
273 0.13
274 0.1
275 0.1
276 0.1
277 0.09
278 0.08
279 0.09
280 0.09
281 0.11
282 0.12
283 0.12
284 0.13
285 0.14
286 0.22
287 0.31
288 0.4
289 0.47
290 0.57
291 0.67
292 0.76
293 0.86
294 0.85
295 0.83
296 0.84
297 0.85
298 0.82
299 0.73
300 0.63
301 0.54
302 0.47
303 0.38
304 0.27
305 0.16
306 0.08
307 0.06
308 0.05
309 0.04
310 0.03
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.06
317 0.05
318 0.06
319 0.06
320 0.05
321 0.05
322 0.05
323 0.05
324 0.06
325 0.09
326 0.1
327 0.12
328 0.13
329 0.13
330 0.14
331 0.14
332 0.14
333 0.16
334 0.16
335 0.16
336 0.18