Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PJQ9

Protein Details
Accession U7PJQ9    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
150-179SDRQAKLDQKKQSLRKKRKRPGKEGSGGDDBasic
NLS Segment(s)
PositionSequence
16-46SGIKNSKSSKSGGGRSSGAEGVVKTKRDKGK
92-100KPKGKKKGK
152-173RQAKLDQKKQSLRKKRKRPGKE
192-200KAGKPKKKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPTRTIKNKHATNKSGIKNSKSSKSGGGRSSGAEGVVKTKRDKGKIPASQLNSGRSKMLELLQRRRKTRTYSEKELDIPKLNTITPVGVQKPKGKKKGKVFVDDKESMTTILAMVQAEKDGQIESKIMKSRQMEEIRQARLAEAEKKESDRQAKLDQKKQSLRKKRKRPGKEGSGGDDDESVGHLASAGTKAGKPKKKRVSFAGAASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.75
4 0.73
5 0.68
6 0.67
7 0.68
8 0.68
9 0.61
10 0.56
11 0.54
12 0.56
13 0.58
14 0.52
15 0.49
16 0.42
17 0.41
18 0.42
19 0.33
20 0.26
21 0.2
22 0.17
23 0.19
24 0.22
25 0.23
26 0.23
27 0.3
28 0.36
29 0.4
30 0.45
31 0.48
32 0.54
33 0.58
34 0.64
35 0.64
36 0.62
37 0.64
38 0.62
39 0.6
40 0.52
41 0.46
42 0.39
43 0.31
44 0.28
45 0.22
46 0.23
47 0.23
48 0.28
49 0.37
50 0.46
51 0.52
52 0.54
53 0.58
54 0.59
55 0.6
56 0.63
57 0.64
58 0.63
59 0.66
60 0.66
61 0.64
62 0.62
63 0.58
64 0.51
65 0.44
66 0.36
67 0.28
68 0.26
69 0.23
70 0.2
71 0.17
72 0.14
73 0.11
74 0.13
75 0.15
76 0.16
77 0.19
78 0.25
79 0.35
80 0.42
81 0.51
82 0.55
83 0.6
84 0.66
85 0.73
86 0.72
87 0.72
88 0.68
89 0.62
90 0.62
91 0.57
92 0.48
93 0.39
94 0.33
95 0.24
96 0.2
97 0.15
98 0.08
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.05
110 0.05
111 0.06
112 0.07
113 0.11
114 0.15
115 0.15
116 0.2
117 0.22
118 0.24
119 0.32
120 0.37
121 0.34
122 0.39
123 0.45
124 0.42
125 0.42
126 0.39
127 0.3
128 0.28
129 0.29
130 0.27
131 0.23
132 0.25
133 0.25
134 0.29
135 0.32
136 0.35
137 0.38
138 0.35
139 0.37
140 0.42
141 0.5
142 0.55
143 0.6
144 0.61
145 0.64
146 0.7
147 0.75
148 0.76
149 0.78
150 0.81
151 0.85
152 0.89
153 0.9
154 0.92
155 0.93
156 0.92
157 0.92
158 0.91
159 0.89
160 0.82
161 0.78
162 0.72
163 0.62
164 0.52
165 0.42
166 0.31
167 0.22
168 0.19
169 0.13
170 0.07
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.09
178 0.11
179 0.2
180 0.29
181 0.39
182 0.46
183 0.56
184 0.66
185 0.74
186 0.8
187 0.8
188 0.8
189 0.77