Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7PV27

Protein Details
Accession U7PV27    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-133GEAALKKAKKAKKAKKKKAAPNPANKEPSNHydrophilic
365-389KLNDGSAQKPKRSRKQRTVVDSSSDHydrophilic
NLS Segment(s)
PositionSequence
107-125ALKKAKKAKKAKKKKAAPN
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MPYPTTAPAQRVPAWKRLGLKLKGSDGNPASPAATIAVSPPAPPPSSFSASTRQPYQSSPSSYSQTNTPSKRKEPPASALASSAAKRQKSVSFAEGGTANKTNGEAALKKAKKAKKAKKKKAAPNPANKEPSNLDRELEYLQQWKTARDVWKFNKNHQTLLIKYVFAGGSNNAGIPTSHIDIFYDYIRSLQGAVRTRLRDEATNICKMDDVADITIDAPRTSTSTSTTATTTAATGEATPKKAKTEAEAAAEAEYAKIVAGFRDQAASGAVNGNGKRLRRLSEVDYVLRFADPVLQKRLVRRIRAENVANELSSEEDGEVVTAAAAAAASIPKAAQSGSTSDVPSTSYLSSSSATTSGGDDKRVKLNDGSAQKPKRSRKQRTVVDSSSDDSDSDSDTDSDSDSGEDGDGAKVEGGADSSSDSSDSSDDSDDEMVPLPTANGAQTSSSSSSSSSPASASDSDSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.55
4 0.58
5 0.62
6 0.59
7 0.62
8 0.6
9 0.62
10 0.64
11 0.59
12 0.58
13 0.51
14 0.49
15 0.42
16 0.37
17 0.3
18 0.24
19 0.23
20 0.16
21 0.13
22 0.1
23 0.09
24 0.13
25 0.12
26 0.13
27 0.16
28 0.19
29 0.2
30 0.2
31 0.24
32 0.27
33 0.31
34 0.33
35 0.33
36 0.36
37 0.41
38 0.45
39 0.46
40 0.43
41 0.4
42 0.41
43 0.45
44 0.45
45 0.44
46 0.45
47 0.44
48 0.43
49 0.43
50 0.41
51 0.39
52 0.4
53 0.43
54 0.46
55 0.5
56 0.54
57 0.59
58 0.67
59 0.72
60 0.73
61 0.7
62 0.69
63 0.67
64 0.63
65 0.57
66 0.49
67 0.41
68 0.36
69 0.3
70 0.3
71 0.29
72 0.25
73 0.26
74 0.29
75 0.31
76 0.32
77 0.36
78 0.32
79 0.3
80 0.29
81 0.3
82 0.29
83 0.25
84 0.25
85 0.22
86 0.19
87 0.16
88 0.16
89 0.14
90 0.13
91 0.16
92 0.14
93 0.17
94 0.27
95 0.28
96 0.32
97 0.4
98 0.44
99 0.5
100 0.6
101 0.67
102 0.67
103 0.78
104 0.85
105 0.87
106 0.93
107 0.93
108 0.93
109 0.94
110 0.92
111 0.92
112 0.89
113 0.88
114 0.84
115 0.73
116 0.66
117 0.58
118 0.54
119 0.49
120 0.41
121 0.32
122 0.26
123 0.27
124 0.25
125 0.23
126 0.19
127 0.18
128 0.17
129 0.21
130 0.22
131 0.21
132 0.21
133 0.25
134 0.3
135 0.31
136 0.4
137 0.42
138 0.51
139 0.53
140 0.59
141 0.63
142 0.58
143 0.55
144 0.51
145 0.5
146 0.41
147 0.46
148 0.39
149 0.29
150 0.27
151 0.28
152 0.21
153 0.16
154 0.16
155 0.09
156 0.09
157 0.09
158 0.09
159 0.07
160 0.07
161 0.07
162 0.08
163 0.1
164 0.1
165 0.1
166 0.1
167 0.1
168 0.11
169 0.12
170 0.11
171 0.09
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.14
179 0.17
180 0.2
181 0.25
182 0.26
183 0.26
184 0.29
185 0.29
186 0.25
187 0.24
188 0.3
189 0.29
190 0.32
191 0.31
192 0.28
193 0.26
194 0.24
195 0.22
196 0.15
197 0.12
198 0.08
199 0.07
200 0.07
201 0.07
202 0.09
203 0.07
204 0.06
205 0.05
206 0.05
207 0.07
208 0.07
209 0.08
210 0.09
211 0.11
212 0.12
213 0.13
214 0.13
215 0.13
216 0.12
217 0.12
218 0.09
219 0.08
220 0.07
221 0.06
222 0.05
223 0.1
224 0.11
225 0.13
226 0.14
227 0.14
228 0.15
229 0.17
230 0.18
231 0.16
232 0.2
233 0.21
234 0.22
235 0.22
236 0.21
237 0.19
238 0.19
239 0.16
240 0.1
241 0.07
242 0.04
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.05
249 0.06
250 0.06
251 0.07
252 0.06
253 0.07
254 0.07
255 0.07
256 0.07
257 0.08
258 0.1
259 0.1
260 0.13
261 0.15
262 0.15
263 0.19
264 0.2
265 0.23
266 0.24
267 0.28
268 0.29
269 0.34
270 0.37
271 0.35
272 0.34
273 0.31
274 0.27
275 0.23
276 0.19
277 0.11
278 0.14
279 0.15
280 0.18
281 0.22
282 0.26
283 0.28
284 0.32
285 0.42
286 0.41
287 0.43
288 0.45
289 0.49
290 0.51
291 0.57
292 0.56
293 0.48
294 0.48
295 0.44
296 0.37
297 0.28
298 0.23
299 0.17
300 0.14
301 0.12
302 0.06
303 0.05
304 0.05
305 0.05
306 0.05
307 0.04
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.02
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.03
320 0.04
321 0.04
322 0.05
323 0.07
324 0.09
325 0.13
326 0.15
327 0.15
328 0.15
329 0.15
330 0.15
331 0.15
332 0.14
333 0.11
334 0.1
335 0.1
336 0.12
337 0.12
338 0.12
339 0.12
340 0.1
341 0.1
342 0.1
343 0.11
344 0.17
345 0.17
346 0.22
347 0.23
348 0.26
349 0.32
350 0.33
351 0.34
352 0.29
353 0.32
354 0.35
355 0.38
356 0.41
357 0.44
358 0.48
359 0.53
360 0.6
361 0.66
362 0.69
363 0.74
364 0.79
365 0.8
366 0.85
367 0.88
368 0.89
369 0.88
370 0.8
371 0.75
372 0.67
373 0.58
374 0.5
375 0.41
376 0.31
377 0.23
378 0.2
379 0.16
380 0.14
381 0.13
382 0.11
383 0.11
384 0.12
385 0.12
386 0.11
387 0.1
388 0.09
389 0.08
390 0.08
391 0.08
392 0.07
393 0.07
394 0.07
395 0.07
396 0.07
397 0.07
398 0.06
399 0.07
400 0.06
401 0.06
402 0.06
403 0.06
404 0.07
405 0.08
406 0.08
407 0.08
408 0.09
409 0.09
410 0.09
411 0.1
412 0.11
413 0.11
414 0.11
415 0.13
416 0.14
417 0.13
418 0.14
419 0.14
420 0.12
421 0.11
422 0.11
423 0.09
424 0.09
425 0.09
426 0.09
427 0.08
428 0.09
429 0.1
430 0.11
431 0.16
432 0.18
433 0.18
434 0.19
435 0.19
436 0.2
437 0.21
438 0.22
439 0.18
440 0.16
441 0.16
442 0.2
443 0.19
444 0.2
445 0.21