Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PQH8

Protein Details
Accession U7PQH8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-50TTKITCRYSVKPKPARRVKKAKDGEALHydrophilic
NLS Segment(s)
PositionSequence
34-45KPKPARRVKKAK
159-170GGVKGKKKKGKR
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MATFATSQQWLHQSSLLLEARPHTTKITCRYSVKPKPARRVKKAKDGEALPDAPPAATNAVGQNPRAKLVLKTVDPASGVCLKYETTKAAEVSRLVQLLGQLSRRQAGLVAGTASAEEQADDVAMAEAAATAADESGAAPSPAPTPAPAQQQQGGGGGGGVKGKKKKGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.27
4 0.23
5 0.22
6 0.22
7 0.26
8 0.27
9 0.27
10 0.22
11 0.24
12 0.3
13 0.38
14 0.43
15 0.44
16 0.47
17 0.53
18 0.61
19 0.66
20 0.7
21 0.72
22 0.73
23 0.78
24 0.84
25 0.86
26 0.86
27 0.88
28 0.85
29 0.86
30 0.85
31 0.8
32 0.76
33 0.67
34 0.62
35 0.56
36 0.5
37 0.39
38 0.32
39 0.26
40 0.19
41 0.17
42 0.13
43 0.09
44 0.07
45 0.08
46 0.08
47 0.12
48 0.13
49 0.14
50 0.18
51 0.17
52 0.18
53 0.18
54 0.18
55 0.15
56 0.19
57 0.24
58 0.2
59 0.22
60 0.21
61 0.21
62 0.2
63 0.19
64 0.16
65 0.16
66 0.15
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.13
73 0.1
74 0.12
75 0.12
76 0.13
77 0.14
78 0.13
79 0.13
80 0.13
81 0.12
82 0.1
83 0.1
84 0.09
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11
90 0.12
91 0.12
92 0.12
93 0.1
94 0.1
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.09
130 0.09
131 0.1
132 0.13
133 0.19
134 0.27
135 0.3
136 0.33
137 0.35
138 0.36
139 0.36
140 0.33
141 0.28
142 0.2
143 0.16
144 0.13
145 0.1
146 0.12
147 0.13
148 0.18
149 0.23
150 0.32