Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PVT9

Protein Details
Accession U7PVT9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-42LWKIPWRLSRFQKYRQRKRLQAVDTHydrophilic
79-105KYTIFDRKAKRYRKGIHRLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-98RKAKRYRKGIHRLP
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto_nucl 3.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGLGPFRATNPLSGGLLWKIPWRLSRFQKYRQRKRLQAVDTVIGTLDTALAKQGQTLNALERWKEEMPKEEEMQARDKYTIFDRKAKRYRKGIHRLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.16
4 0.17
5 0.16
6 0.17
7 0.17
8 0.19
9 0.25
10 0.28
11 0.35
12 0.44
13 0.54
14 0.57
15 0.65
16 0.73
17 0.78
18 0.84
19 0.86
20 0.86
21 0.83
22 0.86
23 0.85
24 0.77
25 0.73
26 0.65
27 0.57
28 0.47
29 0.39
30 0.3
31 0.2
32 0.17
33 0.09
34 0.07
35 0.04
36 0.03
37 0.04
38 0.04
39 0.04
40 0.05
41 0.07
42 0.07
43 0.08
44 0.09
45 0.1
46 0.13
47 0.14
48 0.13
49 0.13
50 0.16
51 0.16
52 0.18
53 0.18
54 0.22
55 0.25
56 0.29
57 0.29
58 0.29
59 0.31
60 0.31
61 0.35
62 0.3
63 0.26
64 0.24
65 0.23
66 0.21
67 0.24
68 0.31
69 0.3
70 0.37
71 0.42
72 0.52
73 0.61
74 0.68
75 0.7
76 0.71
77 0.77
78 0.8
79 0.84
80 0.84
81 0.85
82 0.86
83 0.88
84 0.86
85 0.85
86 0.82
87 0.8
88 0.79
89 0.78
90 0.78
91 0.76
92 0.79