Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7Q196

Protein Details
Accession U7Q196   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-43RNDSKTFRFCRSKCHKNFKMKRNPRKLKWTKAFRKASGKEHydrophilic
NLS Segment(s)
PositionSequence
21-39FKMKRNPRKLKWTKAFRKA
82-107ARRERHFYKRRMAGNRKRELLAARKL
118-129RPQRPLHPKLRA
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MFVRNDSKTFRFCRSKCHKNFKMKRNPRKLKWTKAFRKASGKEMVVDSTLLFAARRNVPVRYNRELAAKTLAAMDQIAEIRARRERHFYKRRMAGNRKRELLAARKLVAEHGHLLMPRPQRPLHPKLRAAAEAKKLAALREAGVDVDVELEDLEVDTTDGVKSKTAARRVVRQRITADGRVELAEEDVGNSSALVDEDAGDDDFDEDDDEMDMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.74
4 0.8
5 0.8
6 0.81
7 0.91
8 0.91
9 0.92
10 0.92
11 0.93
12 0.93
13 0.94
14 0.92
15 0.93
16 0.92
17 0.91
18 0.91
19 0.91
20 0.9
21 0.9
22 0.89
23 0.85
24 0.86
25 0.78
26 0.75
27 0.71
28 0.61
29 0.53
30 0.46
31 0.4
32 0.3
33 0.27
34 0.2
35 0.13
36 0.12
37 0.09
38 0.07
39 0.07
40 0.12
41 0.14
42 0.18
43 0.19
44 0.22
45 0.27
46 0.36
47 0.42
48 0.42
49 0.42
50 0.4
51 0.43
52 0.41
53 0.37
54 0.33
55 0.26
56 0.2
57 0.19
58 0.17
59 0.12
60 0.11
61 0.09
62 0.06
63 0.06
64 0.07
65 0.06
66 0.07
67 0.09
68 0.14
69 0.17
70 0.18
71 0.26
72 0.33
73 0.43
74 0.53
75 0.56
76 0.6
77 0.65
78 0.71
79 0.72
80 0.76
81 0.75
82 0.75
83 0.76
84 0.69
85 0.62
86 0.56
87 0.5
88 0.46
89 0.43
90 0.35
91 0.3
92 0.28
93 0.27
94 0.26
95 0.23
96 0.17
97 0.12
98 0.1
99 0.1
100 0.1
101 0.11
102 0.15
103 0.18
104 0.2
105 0.22
106 0.22
107 0.28
108 0.35
109 0.43
110 0.47
111 0.51
112 0.51
113 0.51
114 0.53
115 0.51
116 0.47
117 0.45
118 0.4
119 0.34
120 0.32
121 0.31
122 0.28
123 0.24
124 0.22
125 0.17
126 0.12
127 0.11
128 0.12
129 0.09
130 0.09
131 0.08
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.04
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.06
147 0.06
148 0.07
149 0.08
150 0.15
151 0.22
152 0.27
153 0.35
154 0.38
155 0.48
156 0.57
157 0.66
158 0.64
159 0.63
160 0.59
161 0.6
162 0.62
163 0.57
164 0.49
165 0.4
166 0.36
167 0.31
168 0.29
169 0.21
170 0.15
171 0.11
172 0.09
173 0.08
174 0.08
175 0.09
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.06
182 0.05
183 0.05
184 0.06
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.08
193 0.07
194 0.07